Products

cDNA Clones (36)
Proteins (25)
Antibodies (5)
Jump to Filters
View as table Download
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone
RC201345

USD 420.00

In Stock

DDC (Myc-DDK-tagged)-Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone Lentiviral Particle
RC219037L1V

USD 820.00

3 Weeks

Lenti ORF particles, DDC (Myc-DDK tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone
RG219037

USD 460.00

In Stock

DDC (GFP-tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone
RG201345

USD 460.00

In Stock

DDC (GFP-tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone
RC201345L3

USD 620.00

3 Weeks

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone Lentiviral Particle
RC201345L3V

USD 820.00

5 Weeks

Lenti ORF particles, DDC (Myc-DDK tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone
RC201345L4

USD 620.00

3 Weeks

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone Lentiviral Particle
RC201345L4V

USD 820.00

7 Weeks

Lenti ORF particles, DDC (mGFP-tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone
RC219037L3

USD 620.00

3 Weeks

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone Lentiviral Particle
RC219037L3V

USD 820.00

5 Weeks

Lenti ORF particles, DDC (Myc-DDK tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone
RC219037L4

USD 620.00

3 Weeks

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone Lentiviral Particle
RC219037L4V

USD 820.00

7 Weeks

Lenti ORF particles, DDC (mGFP-tagged) - Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001242890) Human Tagged ORF Clone
RC232521

USD 420.00

3 Weeks

DDC (Myc-DDK tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242889) Human Tagged ORF Clone
RC232635

USD 420.00

3 Weeks

DDC (Myc-DDK tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242888) Human Tagged ORF Clone
RC232662

USD 420.00

3 Weeks

DDC (Myc-DDK tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242887) Human Tagged ORF Clone
RC232710

USD 420.00

3 Weeks

DDC (Myc-DDK tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242886) Human Tagged ORF Clone
RC232733

USD 420.00

3 Weeks

DDC (Myc-DDK tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242890) Human Tagged ORF Clone
RG232521

USD 460.00

3 Weeks

DDC (GFP-tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242889) Human Tagged ORF Clone
RG232635

USD 460.00

3 Weeks

DDC (GFP-tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242888) Human Tagged ORF Clone
RG232662

USD 460.00

3 Weeks

DDC (GFP-tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242887) Human Tagged ORF Clone
RG232710

USD 460.00

3 Weeks

DDC (GFP-tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
DOPA Decarboxylase (DDC) (NM_001242886) Human Tagged ORF Clone
RG232733

USD 460.00

3 Weeks

DDC (GFP-tagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AADC / DDC (1-480, His-tag) Human Protein
AR09186PU-L

USD 845.00

2 Weeks

AADC / DDC (1-480, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
DOPA Decarboxylase (DDC) (NM_000790) Human Untagged Clone
SC300132

USD 760.00

In Stock

DDC (untagged)-Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA346050

USD 410.00

5 Days

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone
RC201345L1

USD 768.00

In Stock

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA309108

USD 415.00

In Stock

Rabbit Anti-DOPA Decarboxylase, Human Antibody

Applications WB
Reactivities Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA346051

USD 475.00

5 Days

Rabbit Polyclonal Anti-DDC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL
DOPA Decarboxylase (DDC) (NM_001082971) Human Over-expression Lysate
LY421202

USD 605.00

In Stock

Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DOPA Decarboxylase (DDC) (NM_000790) Human Tagged ORF Clone
RC201345L2

USD 620.00

3 Weeks

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DOPA Decarboxylase (DDC) (NM_001082971) Human Tagged ORF Clone
RC219037L2

USD 620.00

3 Weeks

Lenti ORF clone of Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
DOPA Decarboxylase (DDC) Rabbit Polyclonal Antibody
TA326643

USD 430.00

5 Days

Rabbit Polyclonal DDC Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC
DOPA Decarboxylase (DDC) (NM_000790) Human Over-expression Lysate
LC400270

USD 121.00

In Stock

DDC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
DOPA Decarboxylase (DDC) (NM_001082971) Human Over-expression Lysate
LC421202

USD 187.00

In Stock

DDC HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DOPA Decarboxylase (DDC) (NM_001082971) Human Untagged Clone
SC316001

USD 760.00

5 Days

DDC (untagged)-Human dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
DOPA Decarboxylase (DDC) Goat Polyclonal Antibody
TA302469

USD 375.00

5 Days

Goat Polyclonal Antibody against DOPA decarboxylase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-WEHIKELAADVL, from the C Terminus of the protein sequence according to NP_000781.1.
AADC / DDC (1-480, His-tag) Human Protein
AR09186PU-N

USD 330.00

2 Weeks

AADC / DDC (1-480, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
DOPA Decarboxylase (DDC) (NM_000790) Human Over-expression Lysate
LY400270

USD 396.00

5 Days

Transient overexpression lysate of dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
DOPA Decarboxylase (DDC) (NM_000790) Human Mass Spec Standard
PH301345

USD 2,055.00

3 Weeks

DDC MS Standard C13 and N15-labeled recombinant protein (NP_000781)

Tag C-Myc/DDK
Expression Host HEK293
DOPA Decarboxylase (DDC) (NM_001082971) Human Mass Spec Standard
PH319037

USD 2,055.00

3 Weeks

DDC MS Standard C13 and N15-labeled recombinant protein (NP_001076440)

Tag C-Myc/DDK
Expression Host HEK293
DOPA Decarboxylase (DDC) (NM_001242886) Human Untagged Clone
SC330048

USD 450.00

3 Weeks

DDC (untagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 3

Vector pCMV6 series
Tag Tag Free
DOPA Decarboxylase (DDC) (NM_001242887) Human Untagged Clone
SC330049

USD 430.00

3 Weeks

DDC (untagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 4

Vector pCMV6 series
Tag Tag Free
DOPA Decarboxylase (DDC) (NM_001242888) Human Untagged Clone
SC330050

USD 400.00

3 Weeks

DDC (untagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 5

Vector pCMV6 series
Tag Tag Free
DOPA Decarboxylase (DDC) (NM_001242889) Human Untagged Clone
SC330051

USD 390.00

3 Weeks

DDC (untagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 6

Vector pCMV6 series
Tag Tag Free
DOPA Decarboxylase (DDC) (NM_001242890) Human Untagged Clone
SC330052

USD 350.00

3 Weeks

DDC (untagged) - Homo sapiens dopa decarboxylase (aromatic L-amino acid decarboxylase) (DDC), transcript variant 7

Vector pCMV6 series
Tag Tag Free