Products

cDNA Clones (22)
Proteins (14)
Antibodies (3)
Jump to Filters
View as table Download
ARHGEF1 (NM_199002) Human Tagged ORF Clone
RC221180

USD 420.00

In Stock

ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ARHGEF1 (NM_199002) Human Recombinant Protein
TP321180

USD 867.00

In Stock

Recombinant protein of human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
ARHGEF1 (NM_198977) Human Tagged ORF Clone
RC204022

USD 420.00

In Stock

ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ARHGEF1 (NM_198977) Human Tagged ORF Clone
RC204022L3

USD 620.00

3 Weeks

Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_198977) Human Tagged ORF Clone Lentiviral Particle
RC204022L3V

USD 820.00

6 Weeks

Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_198977) Human Tagged ORF Clone
RC204022L4

USD 620.00

3 Weeks

Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_198977) Human Tagged ORF Clone Lentiviral Particle
RC204022L4V

USD 820.00

6 Weeks

Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_004706) Human Tagged ORF Clone
RC204530

USD 970.00

5 Weeks

ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ARHGEF1 (NM_004706) Human Tagged ORF Clone
RC204530L3

USD 1,170.00

5 Weeks

Lenti-ORF clone of ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_004706) Human Tagged ORF Clone Lentiviral Particle
RC204530L3V

USD 1,370.00

8 Weeks

Lenti ORF particles, ARHGEF1 (Myc-DDK-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_004706) Human Tagged ORF Clone
RC204530L4

USD 1,170.00

5 Weeks

Lenti-ORF clone of ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_004706) Human Tagged ORF Clone Lentiviral Particle
RC204530L4V

USD 1,370.00

8 Weeks

Lenti ORF particles, ARHGEF1 (mGFP-tagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_199002) Human Tagged ORF Clone
RC221180L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_199002) Human Tagged ORF Clone Lentiviral Particle
RC221180L3V

USD 820.00

6 Weeks

Lenti ORF particles, ARHGEF1 (Myc-DDK tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_199002) Human Tagged ORF Clone
RC221180L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_199002) Human Tagged ORF Clone Lentiviral Particle
RC221180L4V

USD 820.00

6 Weeks

Lenti ORF particles, ARHGEF1 (mGFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARHGEF1 (NM_198977) Human Tagged ORF Clone
RG204022

USD 460.00

3 Weeks

ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARHGEF1 (NM_004706) Human Tagged ORF Clone
RG204530

USD 1,070.00

5 Weeks

ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARHGEF1 (NM_199002) Human Tagged ORF Clone
RG221180

USD 460.00

3 Weeks

ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARHGEF1 (NM_004706) Human Untagged Clone
SC117214

USD 310.00

In Stock

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
ARHGEF1 (NM_004706) Human Untagged Clone
SC324167

USD 310.00

In Stock

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ARHGEF1 Rabbit Polyclonal Antibody
TA314863

USD 345.00

4 Weeks

Rabbit polyclonal anti-ARHGEF1 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1.
ARHGEF1 (NM_198977) Human Untagged Clone
SC121265

USD 760.00

In Stock

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
ARHGEF1 Rabbit Polyclonal Antibody
TA343288

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG
ARHGEF1 (NM_198977) Human Over-expression Lysate
LC404700

USD 121.00

2 Weeks

ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARHGEF1 (NM_199002) Human Over-expression Lysate
LC404714

USD 187.00

2 Weeks

ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARHGEF1 (NM_199002) Human Mass Spec Standard
PH321180

USD 2,055.00

3 Weeks

ARHGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_945353)

Tag C-Myc/DDK
Expression Host HEK293
ARHGEF1 (NM_199002) Human Untagged Clone
SC307847

USD 760.00

3 Weeks

ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ARHGEF1 Rabbit Polyclonal Antibody
TA349509

USD 345.00

In Stock

Rabbit Polyclonal Anti-ARHGEF1 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARHGEF1
ARHGEF1 (NM_198977) ICC Control Block
TB404022

USD 1,070.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ARHGEF1 (NM_004706) ICC Control Block
TB404530

USD 1,620.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ARHGEF1 (NM_199002) ICC Control Block
TB421180

USD 1,070.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ARHGEF1 Cytosection
TS404022

USD 225.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ARHGEF1 Cytosection
TS404022P5

USD 889.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ARHGEF1 ICC Control Sections
TS404530P5

USD 889.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ARHGEF1 Cytosection
TS421180

USD 225.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ARHGEF1 Cytosection
TS421180P5

USD 889.00

4 Weeks

Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack