Products

cDNA Clones (34)
Proteins (31)
Antibodies (8)
Jump to Filters
View as table Download
ARF1 (NM_001024227) Human Tagged ORF Clone
RC201240

USD 98.00

USD 390.00

In Stock

ARF1 (Myc-DDK-tagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ARF1 (NM_001024228) Human Tagged ORF Clone
RC212099

USD 98.00

USD 390.00

In Stock

ARF1 (Myc-DDK-tagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ARF1 (NM_001658) Human Tagged ORF Clone
RC202141

USD 98.00

USD 390.00

In Stock

ARF1 (Myc-DDK-tagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ARF1 (NM_001024226) Human Tagged ORF Clone
RC224474

USD 420.00

In Stock

ARF1 (Myc-DDK-tagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ARF1 (NM_001024227) Human Tagged ORF Clone
RG201240

USD 460.00

In Stock

ARF1 (GFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARF1 (NM_001024227) Human Tagged ORF Clone Lentiviral Particle
RC201240L1V

USD 820.00

3 Weeks

Lenti ORF particles, ARF1 (Myc-DDK tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ARF1 (NM_001024227) Human Tagged ORF Clone Lentiviral Particle
RC201240L2V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (mGFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ARF1 (NM_001658) Human Recombinant Protein
TP302141

USD 823.00

In Stock

Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 4

Tag C-Myc/DDK
Expression Host HEK293T
ARF1 (NM_001024227) Human Recombinant Protein
TP301240

USD 823.00

4 Weeks

Recombinant protein of human ADP-ribosylation factor 1 (ARF1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
ARF1 (NM_001024227) Human Tagged ORF Clone
RC201240L4

USD 620.00

In Stock

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001658) Human Tagged ORF Clone
RG202141

USD 460.00

In Stock

ARF1 (GFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARF1 (NM_001024226) Human Tagged ORF Clone
RG224474

USD 460.00

In Stock

ARF1 (GFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARF1 (NM_001024227) Human Tagged ORF Clone
RC201240L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024227) Human Tagged ORF Clone Lentiviral Particle
RC201240L3V

USD 820.00

5 Weeks

Lenti ORF particles, ARF1 (Myc-DDK tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024227) Human Tagged ORF Clone Lentiviral Particle
RC201240L4V

USD 820.00

3 Weeks

Lenti ORF particles, ARF1 (mGFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001658) Human Tagged ORF Clone
RC202141L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001658) Human Tagged ORF Clone Lentiviral Particle
RC202141L3V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (Myc-DDK tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001658) Human Tagged ORF Clone
RC202141L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001658) Human Tagged ORF Clone Lentiviral Particle
RC202141L4V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (mGFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024228) Human Tagged ORF Clone
RC212099L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024228) Human Tagged ORF Clone Lentiviral Particle
RC212099L3V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (Myc-DDK tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024228) Human Tagged ORF Clone
RC212099L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024228) Human Tagged ORF Clone Lentiviral Particle
RC212099L4V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (mGFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024226) Human Tagged ORF Clone
RC224474L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024226) Human Tagged ORF Clone Lentiviral Particle
RC224474L3V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (Myc-DDK tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024226) Human Tagged ORF Clone
RC224474L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024226) Human Tagged ORF Clone Lentiviral Particle
RC224474L4V

USD 820.00

6 Weeks

Lenti ORF particles, ARF1 (mGFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ARF1 (NM_001024228) Human Tagged ORF Clone
RG212099

USD 460.00

3 Weeks

ARF1 (GFP-tagged) - Human ADP-ribosylation factor 1 (ARF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ARF1 Rabbit Polyclonal Antibody
TA346559

USD 475.00

5 Days

Rabbit Polyclonal Anti-ARF1 Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ARF1 antibody: synthetic peptide directed towards the middle region of human ARF1. Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
ARF1 (NM_001024227) Human Tagged Lenti ORF Clone
RC201240L1

USD 768.00

In Stock

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ARF1 (NM_001658) Human Untagged Clone
SC119130

USD 310.00

In Stock

ARF1 (untagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ARF1 (NM_001024227) Human Untagged Clone
SC302240

USD 420.00

In Stock

ARF1 (untagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ARF1 Rabbit Polyclonal Antibody
TA308576

USD 415.00

In Stock

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 162 of ARF1 (Uniprot ID#P84077)
ARF1 Mouse Monoclonal Antibody [Clone ID: AT1B3]
AM09395PU-S

USD 230.00

2 Weeks

ARF1 mouse monoclonal antibody, clone AT1B3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
ARF1 (NM_001024226) Human Untagged Clone
SC302239

USD 420.00

3 Weeks

ARF1 (untagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ARF1 (NM_001024228) Human Untagged Clone
SC302241

USD 420.00

3 Weeks

ARF1 (untagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ARF1 Mouse Monoclonal Antibody [Clone ID: AT1B3]
AM09395PU-N

USD 340.00

2 Weeks

ARF1 mouse monoclonal antibody, clone AT1B3, Purified

Applications ELISA, FC, IF, WB
Reactivities Human
ARF1 (NM_001024227) Human Tagged ORF Clone
RC201240L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ADP-ribosylation factor 1 (ARF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ARF1 (NM_001658) Human Over-expression Lysate
LC419819

USD 121.00

In Stock

ARF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARF1 (NM_001024226) Human Over-expression Lysate
LC422625

USD 121.00

In Stock

ARF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARF1 (NM_001024228) Human Over-expression Lysate
LC422627

USD 121.00

In Stock

ARF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARF1 (NM_001024228) Human Over-expression Lysate
LC425449

USD 121.00

In Stock

ARF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARF1 (NM_001658) Human Untagged Clone
SC322506

USD 310.00

In Stock

ARF1 (untagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 4

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ARF1 (NM_001024227) Human Untagged Clone
SC324435

USD 420.00

In Stock

ARF1 (untagged)-Human ADP-ribosylation factor 1 (ARF1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ARF1 Rabbit Polyclonal Antibody
TA308574

USD 415.00

5 Days

Rabbit Polyclonal antibody to ARF1 (ADP-ribosylation factor 1)

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 50 and 104 of ARF1
ARF1 Goat Polyclonal Antibody
TA303176

USD 375.00

5 Days

Goat Polyclonal Antibody against ARF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGLDWLSNQLRNQK, from the C Terminus of the protein sequence according to NP_001019397.1; NP_001649.1; NP_001019398.1; NP_001019399.1.
ARF1 (1-181, His-tag) Human Protein
AR09581PU-L

USD 845.00

2 Weeks

ARF1 (1-181, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
ARF1 (1-181, His-tag) Human Protein
AR09581PU-N

USD 330.00

2 Weeks

ARF1 (1-181, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
ARF1 (NM_001024227) Human Over-expression Lysate
LC422626

USD 121.00

2 Weeks

ARF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ARF1 (NM_001024227) Human Over-expression Lysate
LC425448

USD 121.00

2 Weeks

ARF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB