Products

cDNA Clones (13)
Antibodies (8)
Proteins (7)
Jump to Filters
View as table Download
RICTOR (NM_152756) Human Tagged ORF Clone
RG212982

USD 1,970.00

In Stock

RICTOR (GFP-tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RICTOR (NM_152756) Human Tagged ORF Clone
RC212982

USD 1,790.00

In Stock

RICTOR (Myc-DDK-tagged)-Human RPTOR independent companion of MTOR, complex 2 (RICTOR)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RICTOR (NM_152756) Human Tagged ORF Clone Lentiviral Particle
RC212982L1V

USD 2,190.00

6 Weeks

Lenti ORF particles, RICTOR (Myc-DDK tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
RICTOR (NM_152756) Human Tagged ORF Clone
RC212982L3

USD 1,990.00

3 Weeks

Lenti ORF clone of Human RPTOR independent companion of MTOR, complex 2 (RICTOR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RICTOR (NM_152756) Human Tagged ORF Clone Lentiviral Particle
RC212982L3V

USD 2,190.00

6 Weeks

Lenti ORF particles, RICTOR (Myc-DDK tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RICTOR (NM_001285440) Human Tagged ORF Clone
RC240129

USD 1,450.00

5 Weeks

RICTOR (myc-DDK-tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RICTOR (NM_001285439) Human Tagged ORF Clone
RC240205

USD 1,820.00

6 Weeks

RICTOR (myc-DDK-tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RICTOR (1-99) Mouse Monoclonal Antibody [Clone ID: 1F3]
AM31901PU-N

USD 480.00

2 Weeks

RICTOR (1-99) mouse monoclonal antibody, clone 1F3, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
RICTOR (NM_152756) Human Untagged Clone
SC316453

USD 2,820.00

In Stock

RICTOR (untagged)-Human RPTOR independent companion of MTOR, complex 2 (RICTOR)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
RICTOR Mouse Monoclonal Antibody [Clone ID: 7B3]
TA336802

USD 424.00

5 Days

Mouse Monoclonal Rictor Antibody (7B3)

Applications FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
TA336802 is a replacement of AM06499SU-N.
RICTOR (NM_152756) Human Tagged ORF Clone
RC212982L1

USD 1,990.00

3 Weeks

Lenti ORF clone of Human RPTOR independent companion of MTOR, complex 2 (RICTOR), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RICTOR Rabbit Polyclonal Antibody
TA308477

USD 415.00

5 Days

Rabbit polyclonal antibody to RICTOR

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1648 and 1708 of RICTOR (Uniprot ID#Q6R327)
RICTOR Rabbit Polyclonal Antibody
TA319016

USD 355.00

3 Weeks

Rabbit polyclonal anti-Rictor antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 1639 of mouse Rictor
RICTOR (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 1G11]
AM20222PU-N

USD 465.00

2 Weeks

RICTOR (incl. pos. control) mouse monoclonal antibody, clone 1G11, Purified

Applications WB
Reactivities Human, Mouse, Rat
RICTOR Goat Polyclonal Antibody
TA303018

USD 375.00

5 Days

Goat Polyclonal Antibody against RICTOR

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KQPIVDTSAES, from the C Terminus of the protein sequence according to NP_689969.2.
RICTOR (NM_001285440) Human Tagged ORF Clone
RG240129

USD 1,490.00

2 Weeks

RICTOR (GFP-tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RICTOR (NM_001285439) Human Tagged ORF Clone
RG240205

USD 1,860.00

2 Weeks

RICTOR (GFP-tagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RICTOR (NM_001285440) Human Untagged Clone
SC338023

USD 1,410.00

5 Weeks

RICTOR (untagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RICTOR (NM_001285439) Human Untagged Clone
SC338099

USD 1,760.00

6 Weeks

RICTOR (untagged) - Human RPTOR independent companion of MTOR, complex 2 (RICTOR), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
RICTOR Rabbit Polyclonal Antibody
TA349591

USD 345.00

In Stock

Rabbit Polyclonal Anti-RICTOR Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RICTOR
RICTOR Rabbit Polyclonal Antibody
TA357866

USD 360.00

5 Days

RICTOR Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence GENDLKFTKNFGTENHRENTSRERLVVESSTSSHMKIRSQSFNTDTTTSG
RICTOR (NM_152756) ICC Control Block
TB412982

USD 2,440.00

4 Weeks

Transient overexpression of RICTOR (NM_152756) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RICTOR (NM_001285440) ICC Control Block
TB440129

USD 2,100.00

4 Weeks

Transient overexpression of RICTOR (NM_001285440) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RICTOR (NM_001285439) ICC Control Block
TB440205

USD 2,470.00

4 Weeks

Transient overexpression of RICTOR (NM_001285439) in HEK293T cells paraffin embedded controls for ICC/IHC staining

RICTOR Cytosection
TS412982

USD 225.00

4 Weeks

Transient overexpression of RICTOR (NM_152756) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

RICTOR Cytosection
TS412982P5

USD 889.00

4 Weeks

Transient overexpression of RICTOR (NM_152756) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RICTOR ICC Control Sections
TS440129P5

USD 889.00

4 Weeks

Transient overexpression of RICTOR (NM_001285440) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

RICTOR ICC Control Sections
TS440205P5

USD 889.00

4 Weeks

Transient overexpression of RICTOR (NM_001285439) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack