Products

View as table Download

Recombinant protein of human stratifin (SFN)

Tag C-Myc/DDK
Expression Host HEK293T

SFN (GFP-tagged) - Human stratifin (SFN)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SFN (untagged)-Human stratifin (SFN)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit anti-SFN Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFN

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Lenti ORF clone of Human stratifin (SFN), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SFN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Goat Polyclonal Antibody against 14-3-3 sigma / Stratifin

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLHTLSEDSYKDST, from the internal region of the protein sequence according to NP_006133.1.

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.

Rabbit polyclonal SFN Antibody (Center)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SFN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the Central region of human SFN.

Rabbit Polyclonal Anti-SFN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the N terminal of human SFN. Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL

Rabbit Polyclonal Anti-SFN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN. Synthetic peptide located within the following region: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

14-3-3 protein sigma / SFN (1-248) human recombinant protein, 0.5 mg

Expression Host E. coli

14-3-3 protein sigma / SFN (1-248) human recombinant protein, 0.1 mg

Expression Host E. coli

SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)

Tag C-Myc/DDK
Expression Host HEK293

Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli

Recombinant protein of human stratifin (SFN)

Tag tag free
Expression Host E. coli

Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack