SFN (Myc-DDK-tagged)-Human stratifin (SFN)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SFN (Myc-DDK-tagged)-Human stratifin (SFN)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human stratifin (SFN)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, SFN (Myc-DDK tagged) - Human stratifin (SFN), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, SFN (mGFP-tagged) - Human stratifin (SFN), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SFN (GFP-tagged) - Human stratifin (SFN)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, SFN (Myc-DDK tagged) - Human stratifin (SFN), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, SFN (mGFP-tagged) - Human stratifin (SFN), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit anti-SFN Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFN |
Lenti ORF clone of Human stratifin (SFN), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Transient overexpression lysate of stratifin (SFN)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human stratifin (SFN), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
14-3-3 sigma (SFN) mouse monoclonal antibody, clone 3C3
Applications | IHC, WB |
Reactivities | Human |
SFN HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Goat Polyclonal Antibody against 14-3-3 sigma / Stratifin
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DLHTLSEDSYKDST, from the internal region of the protein sequence according to NP_006133.1. |
Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody
Applications | IHC, WB |
Reactivities | Human, Amphibian, Bovine, Canine, Equine, Opossum |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody. |
Rabbit polyclonal SFN Antibody (Center)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SFN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the Central region of human SFN. |
Rabbit Polyclonal Anti-SFN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFN antibody: synthetic peptide directed towards the N terminal of human SFN. Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL |
Rabbit Polyclonal Anti-SFN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN. Synthetic peptide located within the following region: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT |
14-3-3 protein sigma / SFN (1-248) human recombinant protein, 0.5 mg
Expression Host | E. coli |
14-3-3 protein sigma / SFN (1-248) human recombinant protein, 0.1 mg
Expression Host | E. coli |
SFN MS Standard C13 and N15-labeled recombinant protein (NP_006133)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human stratifin (SFN)
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human stratifin (SFN)
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human stratifin (SFN)
Tag | tag free |
Expression Host | E. coli |
Recombinant protein of human stratifin (SFN)
Tag | tag free |
Expression Host | E. coli |
Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SFN (NM_006142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack