Germany
Japan
United Kingdom
China
TP53I3 (Myc-DDK-tagged)-Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TP53I3 (Myc-DDK-tagged)-Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
TP53I3 (GFP-tagged) - Homo sapiens tumor protein p53 inducible protein 3 (TP53I3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TP53I3 (GFP-tagged) - Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TP53I3 (GFP-tagged) - Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TP53I3 (Myc-DDK tagged) - Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TP53I3 (mGFP-tagged) - Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TP53I3 (Myc-DDK tagged) - Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TP53I3 (mGFP-tagged) - Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TP53I3 (Myc-DDK tagged) - Homo sapiens tumor protein p53 inducible protein 3 (TP53I3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TP53I3 (untagged)-Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TP53I3 (untagged) - Homo sapiens tumor protein p53 inducible protein 3 (TP53I3), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TP53I3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TP53I3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TP53I3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY417682 is the same product as LY429226.
Transient overexpression lysate of tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TP53I3 (untagged)-Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-TP53I3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53I3 antibody is: synthetic peptide directed towards the C-terminal region of Human TP53I3. Synthetic peptide located within the following region: SKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVL |
TP53I3 (1-332, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
TP53I3 (1-332, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) TP53I3 mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_004872)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TP53I3 MS Standard C13 and N15-labeled recombinant protein (NP_671713)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TP53I3 (untagged)-Human tumor protein p53 inducible protein 3 (TP53I3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TP53I3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
TP53I3 (PIG3) mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of TP53I3 (NM_004881) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TP53I3 (NM_147184) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TP53I3 (NM_001206802) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TP53I3 (NM_004881) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TP53I3 (NM_004881) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TP53I3 (NM_147184) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TP53I3 (NM_147184) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TP53I3
Pathways
- p53 signaling pathway