Rabbit anti-GTF2A1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GTF2A1 |
Rabbit anti-GTF2A1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GTF2A1 |
Rabbit Polyclonal Anti-GTF2A1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the middle region of human GTF2A1. Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG |
Rabbit Polyclonal Anti-GTF2A1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the N terminal of human GTF2A1. Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM |
Rabbit Polyclonal anti-GTF2A1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the C terminal of human GTF2A1. Synthetic peptide located within the following region: QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN |
GTF2A1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GTF2A1 |