Germany
Japan
United Kingdom
China
GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadGtf2a1 (Myc-DDK-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN421859 is the updated version of KN221859.
Gtf2a1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN507413 is the updated version of KN307413.
Gtf2a1 (GFP-tagged) - Mouse general transcription factor II A 1 (Gtf2a1) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gtf2a1 (GFP-tagged) - Mouse general transcription factor II A 1 (Gtf2a1) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gtf2a1 (Myc-DDK-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gtf2a1 (Myc-DDK-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1 (Myc-DDK-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2a1 (mGFP-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1 (GFP-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2a1 (Myc-DDK-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1 (Myc-DDK-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2a1 (mGFP-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1 (GFP-tagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (Myc-DDK tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (mGFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (Myc-DDK-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GTF2A1 (mGFP-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GTF2A1 (mGFP-tagged)-Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GTF2A1 (myc-DDK-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1 (GFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GTF2A1 (GFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gtf2a1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIA, 1 (Gtf2a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Gtf2a1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIA, 1 (Gtf2a1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIA, 1 (Gtf2a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Gtf2a1 (mGFP-tagged ORF) - Rat general transcription factor IIA, 1 (Gtf2a1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Gtf2a1 (GFP-tagged ORF) - Rat general transcription factor IIA, 1 (Gtf2a1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-GTF2A1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the middle region of human GTF2A1. Synthetic peptide located within the following region: GQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDG |
Rabbit Polyclonal Anti-GTF2A1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the N terminal of human GTF2A1. Synthetic peptide located within the following region: ANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM |
GTF2A1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal anti-GTF2A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2A1 antibody: synthetic peptide directed towards the C terminal of human GTF2A1. Synthetic peptide located within the following region: QAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVEEEPLN |
GTF2A1 / TF2A1 (1-274, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
GTF2A1 / TF2A1 (1-274, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
GTF2A1 CRISPRa kit - CRISPR gene activation of human general transcription factor IIA subunit 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Gtf2a1 CRISPRa kit - CRISPR gene activation of mouse general transcription factor II A, 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GTF2A1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GTF2A1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Gtf2a1 (untagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Gtf2a1 (untagged) - Mouse general transcription factor II A, 1 (Gtf2a1), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Gtf2a1
GTF2A1 (GFP-tagged) - Human general transcription factor IIA, 1, 19/37kDa (GTF2A1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Gtf2a1 (untagged ORF) - Rat general transcription factor IIA, 1 (Gtf2a1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of general transcription factor IIA1 19/37kDa (GTF2A1) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Active filters
Target Symbol
- GTF2A1