Products

View as table Download

Rabbit polyclonal anti-Tnfrsf21 (DR6) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 622 of rat DR6

Rabbit Polyclonal DR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen DR6 antibody was raised against a peptide corresponding to amino acids 42 to 56 of human DR6 precursor .

Rabbit Polyclonal Anti-TNFRSF21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF21 antibody: synthetic peptide directed towards the N terminal of human TNFRSF21. Synthetic peptide located within the following region: TTTAQPEQKASNLIGTYRHVDRATGQVLTCDKCPAGTYVSEHCTNTSLRV

Anti-TNFRSF21 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 42-56 amino acids of Human tumor necrosis factor receptor superfamily, member 21

Rabbit Polyclonal Anti-TNFRSF21 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human TNFRSF21