Products

cDNA Clones (32)
Proteins (13)
Primary Antibodies (11)
Gene Expression (8)
RNAi (8)
Jump to Filters
View as table Download
SIAH1 Rabbit Polyclonal Antibody
TA332521

USD 275.00

3 Weeks

Rabbit anti-SIAH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIAH1
SIAH1 (+SIAH2) Rabbit Polyclonal Antibody
AP20448PU-N

USD 370.00

2 Weeks

SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
SIAH1 Rabbit Polyclonal Antibody
TA334774

USD 310.00

5 Days

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA
SIAH1 Rabbit Polyclonal Antibody
TA335795

USD 310.00

5 Days

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
SIAH1 Mouse Monoclonal Antibody [Clone ID: 8G7H12]
TA336573

USD 424.00

5 Days

Mouse Monoclonal SIAH1/2 Antibody (8G7H12)

Applications WB
Reactivities Human, Rat, Drosophila, Porcine, Zebrafish, Mouse
Conjugation Unconjugated
SIAH1 (Center) Rabbit Polyclonal Antibody
AP53913PU-N

USD 450.00

2 Weeks

SIAH1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human SIAH1.
SIAH1 Goat Polyclonal Antibody
TA302689

USD 375.00

5 Days

Goat Polyclonal Antibody against SIAH1

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence SRQTATALPTGTSKC, from the N Terminus of the protein sequence according to NP_003022.3; NP_001006611.1.
SIAH1 Rabbit Polyclonal Antibody
TA350414

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Siah1 Rabbit Polyclonal Antibody
TA363299

USD 360.00

5 Days

SIAH1 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of rat SIAH1A
SIAH1 Rabbit Polyclonal Antibody
TA365015

USD 380.00

4 Weeks

SIAH1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SIAH1
SIAH1 Rabbit Polyclonal Antibody
TA381486

USD 220.00

3 Weeks

SIAH1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-313 of human SIAH1 (NP_001006611.1).
Modifications Unmodified