Products

View as table Download

SIAH1 (Myc-DDK-tagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SIAH1 (Myc-DDK-tagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

SIAH1 (GFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

SIAH1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406576 is the updated version of KN206576.

Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

SIAH1 (GFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Siah1a (Myc-DDK-tagged ORF) - Rat seven in absentia 1A (Siah1a), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Siah1a (Myc-DDK-tagged ORF) - Rat seven in absentia 1A (Siah1a), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Siah1a (Myc-DDK-tagged ORF) - Rat seven in absentia 1A (Siah1a), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Siah1a (mGFP-tagged ORF) - Rat seven in absentia 1A (Siah1a), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Siah1a (GFP-tagged ORF) - Rat seven in absentia 1A (Siah1a), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

SIAH1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-SIAH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIAH1

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

SIAH1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

SIAH1 (untagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

(untagged)-Human cDNA FLJ37344 fis, clone BRAMY2021139, highly similar to Seven in absentia

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

SIAH1 (untagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA

Rabbit Polyclonal Anti-SIAH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP

Mouse Monoclonal SIAH1/2 Antibody (8G7H12)

Applications WB
Reactivities Human, Rat, Drosophila, Porcine, Zebrafish, Mouse
Conjugation Unconjugated

Purified recombinant protein of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

SIAH1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human SIAH1.

SIAH1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro

Transient overexpression lysate of seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Goat Polyclonal Antibody against SIAH1

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence SRQTATALPTGTSKC, from the N Terminus of the protein sequence according to NP_003022.3; NP_001006611.1.

SIAH1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

SIAH1 (90-282, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

SIAH1 (90-282, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

SIAH1 CRISPRa kit - CRISPR gene activation of human siah E3 ubiquitin protein ligase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene SIAH1

Application Plasmid of exact quantity for transcript copy number calculation

qSTAR qPCR primer pairs against Homo sapiens gene SIAH1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

SIAH1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA mBFP-Neo

SIAH1 - human gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA Luciferase-Puro