SIAH1 (Myc-DDK-tagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SIAH1 (Myc-DDK-tagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SIAH1 (Myc-DDK-tagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SIAH1 (GFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
SIAH1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SIAH1 (Myc-DDK tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SIAH1 (mGFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
SIAH1 (GFP-tagged) - Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Siah1a (Myc-DDK-tagged ORF) - Rat seven in absentia 1A (Siah1a), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Siah1a (Myc-DDK-tagged ORF) - Rat seven in absentia 1A (Siah1a), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Siah1a (Myc-DDK-tagged ORF) - Rat seven in absentia 1A (Siah1a), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Siah1a (mGFP-tagged ORF) - Rat seven in absentia 1A (Siah1a), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Siah1a (GFP-tagged ORF) - Rat seven in absentia 1A (Siah1a), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
SIAH1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit anti-SIAH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIAH1 |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SIAH1 (+SIAH2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
SIAH1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
SIAH1 (untagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
(untagged)-Human cDNA FLJ37344 fis, clone BRAMY2021139, highly similar to Seven in absentia
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SIAH1 (untagged)-Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-SIAH1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIAH1 antibody: synthetic peptide directed towards the N terminal of human SIAH1. Synthetic peptide located within the following region: FTCLPAARTRKRKEMSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLA |
Rabbit Polyclonal Anti-SIAH1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SIAH1 Antibody: synthetic peptide directed towards the C terminal of human SIAH1. Synthetic peptide located within the following region: LVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP |
Mouse Monoclonal SIAH1/2 Antibody (8G7H12)
Applications | WB |
Reactivities | Human, Rat, Drosophila, Porcine, Zebrafish, Mouse |
Conjugation | Unconjugated |
Purified recombinant protein of Human seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
SIAH1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 91-121 amino acids from the Central region of human SIAH1. |
SIAH1 - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | GFP-puro |
Transient overexpression lysate of seven in absentia homolog 1 (Drosophila) (SIAH1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against SIAH1
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SRQTATALPTGTSKC, from the N Terminus of the protein sequence according to NP_003022.3; NP_001006611.1. |
SIAH1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
SIAH1 (90-282, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
SIAH1 (90-282, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
SIAH1 CRISPRa kit - CRISPR gene activation of human siah E3 ubiquitin protein ligase 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SIAH1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SIAH1
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
SIAH1 - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | mBFP-Neo |
SIAH1 - human gene knockout kit via CRISPR, HDR mediated
Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
Donor DNA | Luciferase-Puro |