Products

cDNA Clones (50)
Proteins (29)
RNAi (13)
Antibodies (5)
Gene Expression (5)
Jump to Filters
View as table Download
A1CF (NM_014576) Human Tagged ORF Clone
RC213415

USD 480.00

In Stock

A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
A1CF (NM_138932) Human Tagged ORF Clone
RC216861

USD 420.00

In Stock

A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
A1CF (NM_138933) Human Tagged ORF Clone
RC216911

USD 420.00

In Stock

A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
A1cf (NM_001081074) Mouse Tagged ORF Clone
MR224176

USD 480.00

In Stock

A1cf (Myc-DDK-tagged) - Mouse APOBEC1 complementation factor (A1cf)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_001198819) Human Tagged ORF Clone
RC231331

USD 480.00

In Stock

A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_001198818) Human Tagged ORF Clone
RC234498

USD 480.00

In Stock

A1CF (Myc-DDK tagged) - Homo sapiens APOBEC1 complementation factor (A1CF), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_001198820) Human Tagged ORF Clone
RC234515

USD 420.00

In Stock

A1CF (Myc-DDK tagged) - Homo sapiens APOBEC1 complementation factor (A1CF), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_138932) Human Tagged ORF Clone
RG216861

USD 460.00

In Stock

A1CF (GFP-tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF Human Gene Knockout Kit (CRISPR)
KN413415

USD 1,290.00

2 Weeks

A1CF - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN413415 is the updated version of KN213415.
A1cf (NM_001081074) Mouse Tagged ORF Clone
MG224176

USD 530.00

3 Weeks

A1cf (GFP-tagged) - Mouse APOBEC1 complementation factor (A1cf), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1cf (NM_001081074) Mouse Tagged ORF Clone
MR224176L3

USD 680.00

3 Weeks

Lenti ORF clone of A1cf (Myc-DDK-tagged) - Mouse APOBEC1 complementation factor (A1cf)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1cf (NM_001081074) Mouse Tagged ORF Clone
MR224176L4

USD 680.00

3 Weeks

Lenti ORF clone of A1cf (mGFP-tagged) - Mouse APOBEC1 complementation factor (A1cf)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_014576) Human Tagged ORF Clone
RC213415L3

USD 680.00

3 Weeks

Lenti-ORF clone of A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_014576) Human Tagged ORF Clone Lentiviral Particle
RC213415L3V

USD 880.00

6 Weeks

Lenti ORF particles, A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_014576) Human Tagged ORF Clone
RC213415L4

USD 680.00

3 Weeks

Lenti-ORF clone of A1CF (mGFP-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_014576) Human Tagged ORF Clone Lentiviral Particle
RC213415L4V

USD 880.00

6 Weeks

Lenti ORF particles, A1CF (mGFP-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138932) Human Tagged ORF Clone
RC216861L3

USD 620.00

3 Weeks

Lenti ORF clone of Human APOBEC1 complementation factor (A1CF), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138932) Human Tagged ORF Clone Lentiviral Particle
RC216861L3V

USD 820.00

6 Weeks

Lenti ORF particles, A1CF (Myc-DDK tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138932) Human Tagged ORF Clone
RC216861L4

USD 620.00

3 Weeks

Lenti ORF clone of Human APOBEC1 complementation factor (A1CF), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138932) Human Tagged ORF Clone Lentiviral Particle
RC216861L4V

USD 820.00

6 Weeks

Lenti ORF particles, A1CF (mGFP-tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138933) Human Tagged ORF Clone
RC216911L3

USD 620.00

3 Weeks

Lenti ORF clone of Human APOBEC1 complementation factor (A1CF), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138933) Human Tagged ORF Clone Lentiviral Particle
RC216911L3V

USD 820.00

6 Weeks

Lenti ORF particles, A1CF (Myc-DDK tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138933) Human Tagged ORF Clone
RC216911L4

USD 620.00

3 Weeks

Lenti ORF clone of Human APOBEC1 complementation factor (A1CF), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_138933) Human Tagged ORF Clone Lentiviral Particle
RC216911L4V

USD 820.00

6 Weeks

Lenti ORF particles, A1CF (mGFP-tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_001198819) Human Tagged ORF Clone
RC231331L3

USD 680.00

3 Weeks

Lenti-ORF clone of A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 5

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_001198819) Human Tagged ORF Clone Lentiviral Particle
RC231331L3V

USD 880.00

6 Weeks

Lenti ORF particles, A1CF (Myc-DDK-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_001198819) Human Tagged ORF Clone
RC231331L4

USD 680.00

3 Weeks

Lenti-ORF clone of A1CF (mGFP-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 5

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_001198819) Human Tagged ORF Clone Lentiviral Particle
RC231331L4V

USD 880.00

6 Weeks

Lenti ORF particles, A1CF (mGFP-tagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1CF (NM_014576) Human Tagged ORF Clone
RG213415

USD 530.00

3 Weeks

A1CF (GFP-tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_138933) Human Tagged ORF Clone
RG216911

USD 460.00

3 Weeks

A1CF (GFP-tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_001198819) Human Tagged ORF Clone
RG231331

USD 530.00

3 Weeks

A1CF (GFP-tagged) - Human APOBEC1 complementation factor (A1CF), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_001198818) Human Tagged ORF Clone
RG234498

USD 530.00

3 Weeks

A1CF (GFP-tagged) - Homo sapiens APOBEC1 complementation factor (A1CF), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1CF (NM_001198820) Human Tagged ORF Clone
RG234515

USD 460.00

3 Weeks

A1CF (GFP-tagged) - Homo sapiens APOBEC1 complementation factor (A1CF), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
A1cf (NM_133400) Rat Tagged ORF Clone
RR208787

USD 790.00

5 Weeks

A1cf (Myc-DDK-tagged ORF) - Rat APOBEC1 complementation factor (A1cf), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
A1cf (NM_133400) Rat Tagged ORF Clone
RR208787L3

USD 990.00

9 Weeks

Lenti ORF clone of A1cf (Myc-DDK-tagged ORF) - Rat APOBEC1 complementation factor (A1cf), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1cf (NM_133400) Rat Tagged ORF Clone Lentiviral Particle
RR208787L3V

USD 1,210.00

13 Weeks

Lenti ORF particles, A1cf (Myc-DDK-tagged ORF) - Rat APOBEC1 complementation factor (A1cf), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
A1cf (NM_133400) Rat Tagged ORF Clone
RR208787L4

USD 1,080.00

9 Weeks

Lenti ORF clone of A1cf (mGFP-tagged ORF) - Rat APOBEC1 complementation factor (A1cf), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1cf (NM_133400) Rat Tagged ORF Clone Lentiviral Particle
RR208787L4V

USD 1,350.00

13 Weeks

Lenti ORF particles, A1cf (GFP-tagged ORF) - Rat APOBEC1 complementation factor (A1cf), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
A1cf (NM_001081074) Mouse Tagged Lenti ORF Clone
MR224176L1

USD 840.00

In Stock

Lenti ORF clone of A1cf (Myc-DDK-tagged) - Mouse APOBEC1 complementation factor (A1cf)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
A1CF (C-term) Rabbit Polyclonal Antibody
AP50047PU-N

USD 450.00

2 Weeks

A1CF (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 397-427 amino acids from the C-terminal region of human ACF
A1CF Rabbit Polyclonal Antibody
TA343985

USD 475.00

5 Days

Rabbit Polyclonal Anti-A1CF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP
A1CF Rabbit Polyclonal Antibody
TA343814

USD 475.00

5 Days

Rabbit Polyclonal Anti-A1CF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A1CF antibody: synthetic peptide directed towards the N terminal of human A1CF. Synthetic peptide located within the following region: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA
A1CF Rabbit Polyclonal Antibody
TA343984

USD 475.00

5 Days

Rabbit Polyclonal Anti-A1CF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-A1CF antibody is: synthetic peptide directed towards the N-terminal region of Human A1CF. Synthetic peptide located within the following region: LGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPPPGW
A1cf Mouse shRNA Plasmid (Locus ID 69865)
TG517823

USD 715.00

In Stock

A1cf - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
A1cf (NM_001081074) Mouse Tagged ORF Clone
MR224176L2

USD 680.00

3 Weeks

Lenti ORF clone of A1cf (mGFP-tagged) - Mouse APOBEC1 complementation factor (A1cf)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
A1CF (NM_138932) Human Untagged Clone
SC306092

USD 760.00

In Stock

A1CF (untagged)-Human APOBEC1 complementation factor (A1CF), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None