Germany
Japan
United Kingdom
China
ADH7 (Myc-DDK-tagged)-Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ADH7 (Myc-DDK-tagged)-Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Adh7 (Myc-DDK-tagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADH7 (GFP-tagged) - Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ADH7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN424304 is the updated version of KN224304.
Adh7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500905 is the updated version of KN300905.
Adh7 (GFP-tagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Adh7 (Myc-DDK-tagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adh7 (Myc-DDK-tagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adh7 (mGFP-tagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adh7 (GFP-tagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH7 (Myc-DDK tagged) - Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH7 (mGFP-tagged) - Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH7 (Myc-DDK tagged) - Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH7 (mGFP-tagged) - Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADH7 (GFP-tagged) - Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Adh7 (Myc-DDK-tagged ORF) - Rat alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Adh7 (Myc-DDK-tagged ORF) - Rat alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adh7 (Myc-DDK-tagged ORF) - Rat alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Adh7 (mGFP-tagged ORF) - Rat alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Adh7 (GFP-tagged ORF) - Rat alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-Adh7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL |
Rabbit polyclonal ADH7 Antibody (C-Term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7. |
Adh7 (untagged) - Mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADH7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ADH7 (untagged)-Human alcohol dehydrogenase 7 (class IV) mu or sigma polypeptide (ADH7) transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal anti-ADH7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADH7. |
ADH7 CRISPRa kit - CRISPR gene activation of human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Adh7 CRISPRa kit - CRISPR gene activation of mouse alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ADH7
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
ADH7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Adh7
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Adh7
ADH7 MS Standard C13 and N15-labeled recombinant protein (NP_000664)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Adh7 (untagged ORF) - Rat alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (Adh7), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADH7 (untagged)-Human alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (ADH7), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ADH7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Adh7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Adh7 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ADH7 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-386 of human ADH7 (NP_000664.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ADH7