Germany
Japan
United Kingdom
China
ALG11 (Myc-DDK-tagged)-Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Alg11 (Myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Alg11 (Myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (Alg11)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ALG11 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN418890 is the updated version of KN218890.
Alg11 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501134 is the updated version of KN301134.
Alg11 (GFP-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Alg11 (GFP-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast alpha-12-mannosyltransferase) (Alg11), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Alg11 (Myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Alg11 (Myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Alg11 (mGFP-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Alg11 (GFP-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Alg11 (Myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (Alg11)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Alg11 (Myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (Alg11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Alg11 (mGFP-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (Alg11)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Alg11 (GFP-tagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (Alg11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Alg11 (myc-DDK-tagged) - Mouse asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase) (Alg11), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ALG11 (Myc-DDK tagged) - Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ALG11 (mGFP-tagged) - Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ALG11 (GFP-tagged) - Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Alg11 (Myc-DDK-tagged ORF) - Rat asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (Alg11), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Alg11 (Myc-DDK-tagged ORF) - Rat asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (Alg11), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Alg11 (Myc-DDK-tagged ORF) - Rat asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (Alg11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Alg11 (mGFP-tagged ORF) - Rat asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (Alg11), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Alg11 (GFP-tagged ORF) - Rat asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (Alg11), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ALG11 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-ALG11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the C terminal of human ALG11. Synthetic peptide located within the following region: LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES |
ALG11 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 343-373 amino acids from the C-terminal region of human ALG11 |
Transient overexpression lysate of asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ALG11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALG11 antibody: synthetic peptide directed towards the middle region of human ALG11. Synthetic peptide located within the following region: LSEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMA |
ALG11 CRISPRa kit - CRISPR gene activation of human ALG11 alpha-1,2-mannosyltransferase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Alg11 CRISPRa kit - CRISPR gene activation of mouse asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase)
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ALG11
ALG11 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Alg11 (untagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (Alg11), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Alg11 (untagged) - Mouse asparagine-linked glycosylation 11 homolog (yeast, alpha-1,2-mannosyltransferase) (cDNA clone MGC:67180, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Alg11 (untagged) - Mouse asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase) (Alg11), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Alg11
Alg11 (untagged ORF) - Rat asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (Alg11), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ALG11 (untagged)-Homo sapiens, clone MGC:9168 IMAGE:3876839, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
3`UTR clone of asparagine-linked glycosylation 11 alpha-12-mannosyltransferase homolog (yeast) (ALG11) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ALG11 (untagged)-Human asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase homolog (yeast) (ALG11), transcript variant A
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Alg11 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Alg11 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of ALG11 (NM_001004127) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ALG11 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ALG11 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Alg11 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ALG11