Germany
Japan
United Kingdom
China
AMIGO2 (Myc-DDK-tagged)-Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
AMIGO2 (Myc-DDK-tagged)-Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, AMIGO2 (Myc-DDK tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, AMIGO2 (mGFP-tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, AMIGO2 (Myc-DDK tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, AMIGO2 (mGFP-tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AMIGO2 (GFP-tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
AMIGO2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN408004 is the updated version of KN208004.
Amigo2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501195 is the updated version of KN301195.
Amigo2 (GFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Amigo2 (GFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Amigo2 (GFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2) transcript variant 1, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Amigo2 (mGFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (GFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Amigo2 (mGFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (GFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (Myc-DDK-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Amigo2 (mGFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (GFP-tagged) - Mouse adhesion molecule with Ig like domain 2 (Amigo2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AMIGO2 (Myc-DDK tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AMIGO2 (mGFP-tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AMIGO2 (Myc-DDK tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, AMIGO2 (mGFP-tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
AMIGO2 (GFP-tagged) - Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Amigo2 (Myc-DDK-tagged ORF) - Rat adhesion molecule with Ig like domain 2 (Amigo2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Amigo2 (Myc-DDK-tagged ORF) - Rat adhesion molecule with Ig like domain 2 (Amigo2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (Myc-DDK-tagged ORF) - Rat adhesion molecule with Ig like domain 2 (Amigo2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Amigo2 (mGFP-tagged ORF) - Rat adhesion molecule with Ig like domain 2 (Amigo2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Amigo2 (GFP-tagged ORF) - Rat adhesion molecule with Ig like domain 2 (Amigo2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
AMIGO2 (untagged)-Human adhesion molecule with Ig-like domain 2 (AMIGO2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-Amigo2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Amigo2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF |
Rabbit Polyclonal Anti-AMIGO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMIGO2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AMIGO2. Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL |
AMIGO2 / ALI1 (40-398, His-tag) human protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
Active filters
Target Symbol
- AMIGO2