Products

cDNA Clones (48)
Proteins (26)
Antibodies (23)
RNAi (13)
Gene Expression (6)
Jump to Filters
View as table Download
Asl (NM_133768) Mouse Tagged ORF Clone
MR207413

USD 350.00

In Stock

Asl (Myc-DDK-tagged) - Mouse argininosuccinate lyase (Asl)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Asl Mouse Gene Knockout Kit (CRISPR)
KN501683

USD 1,290.00

2 Weeks

Asl - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501683 is the updated version of KN301683.
Asl (NM_133768) Mouse Tagged ORF Clone
MG207413

USD 390.00

3 Weeks

Asl (GFP-tagged) - Mouse argininosuccinate lyase (Asl)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Asl (NM_133768) Mouse Tagged ORF Clone
MR207413L3

USD 550.00

3 Weeks

Lenti ORF clone of Asl (Myc-DDK-tagged) - Mouse argininosuccinate lyase (Asl)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Asl (NM_133768) Mouse Tagged ORF Clone
MR207413L4

USD 550.00

3 Weeks

Lenti ORF clone of Asl (mGFP-tagged) - Mouse argininosuccinate lyase (Asl)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Asl (NM_133768) Mouse Tagged ORF Clone Lentiviral Particle
MR207413L4V

USD 750.00

6 Weeks

Lenti ORF particles, Asl (GFP-tagged) - Mouse argininosuccinate lyase (Asl), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024943) Human Tagged ORF Clone Lentiviral Particle
RC201568L3V

USD 820.00

7 Weeks

Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024943) Human Tagged ORF Clone Lentiviral Particle
RC201568L4V

USD 820.00

7 Weeks

Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_000048) Human Tagged ORF Clone Lentiviral Particle
RC217527L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (Myc-DDK tagged) - Human argininosuccinate lyase (ASL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_000048) Human Tagged ORF Clone Lentiviral Particle
RC217527L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (mGFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024944) Human Tagged ORF Clone Lentiviral Particle
RC217587L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024944) Human Tagged ORF Clone Lentiviral Particle
RC217587L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024946) Human Tagged ORF Clone Lentiviral Particle
RC217708L3V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (Myc-DDK-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024946) Human Tagged ORF Clone Lentiviral Particle
RC217708L4V

USD 820.00

6 Weeks

Lenti ORF particles, ASL (mGFP-tagged)-Human argininosuccinate lyase (ASL), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_000048) Human Tagged ORF Clone
RG217527

USD 460.00

3 Weeks

ASL (GFP-tagged) - Human argininosuccinate lyase (ASL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Asl (NM_021577) Rat Tagged ORF Clone
RR205157

USD 630.00

4 Weeks

Asl (Myc-DDK-tagged ORF) - Rat argininosuccinate lyase (Asl), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Asl (NM_021577) Rat Tagged ORF Clone
RR205157L3

USD 820.00

9 Weeks

Lenti ORF clone of Asl (Myc-DDK-tagged ORF) - Rat argininosuccinate lyase (Asl), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Asl (NM_021577) Rat Tagged ORF Clone Lentiviral Particle
RR205157L3V

USD 1,040.00

13 Weeks

Lenti ORF particles, Asl (Myc-DDK-tagged ORF) - Rat argininosuccinate lyase (Asl), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Asl (NM_021577) Rat Tagged ORF Clone
RR205157L4

USD 910.00

9 Weeks

Lenti ORF clone of Asl (mGFP-tagged ORF) - Rat argininosuccinate lyase (Asl), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Asl (NM_021577) Rat Tagged ORF Clone Lentiviral Particle
RR205157L4V

USD 1,170.00

13 Weeks

Lenti ORF particles, Asl (GFP-tagged ORF) - Rat argininosuccinate lyase (Asl), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Argininosuccinate Lyase (ASL) (NM_001024943) Human Untagged Clone
SC322186

USD 760.00

In Stock

ASL (untagged)-Human argininosuccinate lyase (ASL), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA346154

USD 410.00

2 Weeks

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the middle region of human ASL. Synthetic peptide located within the following region: LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK
Argininosuccinate Lyase (ASL) (NM_001024943) Human Over-expression Lysate
LY422562

USD 396.00

In Stock

Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308495

USD 415.00

5 Days

Rabbit polyclonal antibody to Argininosuccinate Lyase (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 261 of ASL (Uniprot ID#P04424)
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA346153

USD 475.00

5 Days

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the N terminal of human ASL. Synthetic peptide located within the following region: GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE
Argininosuccinate Lyase (ASL) Rabbit Polyclonal Antibody
TA308132

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to ASL (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 86 and 325 of ASL
Argininosuccinate Lyase (ASL) (NM_000048) Human Over-expression Lysate
LC424953

USD 187.00

In Stock

ASL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
ASL Human shRNA Plasmid Kit (Locus ID 435)
TG314628

USD 715.00

In Stock

ASL - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
E. coli Selection Kanamycin
Mammalian Cell Selection Puromycin
Argininosuccinate Lyase (ASL) (NM_001024943) Human Over-expression Lysate
LC422562

USD 121.00

In Stock

ASL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB