Products

cDNA Clones (50)
Proteins (39)
Antibodies (16)
RNAi (4)
Gene Expression (3)
Assay Kits (1)
Jump to Filters
View as table Download
Carbonic Anhydrase I (CA1) (NM_001738) Human Recombinant Protein
TP306616

USD 823.00

In Stock

Recombinant protein of human carbonic anhydrase I (CA1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Carbonic Anhydrase I (CA1) (NM_001128830) Human Tagged ORF Clone
RC225350

USD 420.00

In Stock

CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001128829) Human Tagged ORF Clone
RC225348

USD 420.00

In Stock

CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001128831) Human Tagged ORF Clone
RC225351

USD 420.00

In Stock

CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001164830) Human Tagged ORF Clone
RC228786

USD 420.00

In Stock

CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001738) Human Tagged ORF Clone
RG206616

USD 460.00

In Stock

CA1 (GFP-tagged) - Human carbonic anhydrase I (CA1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001738) Human Tagged ORF Clone Lentiviral Particle
RC206616L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (Myc-DDK tagged) - Human carbonic anhydrase I (CA1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001128829) Human Tagged ORF Clone Lentiviral Particle
RC225348L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001128829) Human Tagged ORF Clone Lentiviral Particle
RC225348L4V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (mGFP-tagged)-Human carbonic anhydrase I (CA1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001128830) Human Tagged ORF Clone Lentiviral Particle
RC225350L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001128830) Human Tagged ORF Clone Lentiviral Particle
RC225350L4V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (mGFP-tagged)-Human carbonic anhydrase I (CA1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001128831) Human Tagged ORF Clone Lentiviral Particle
RC225351L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001128831) Human Tagged ORF Clone Lentiviral Particle
RC225351L4V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (mGFP-tagged)-Human carbonic anhydrase I (CA1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001164830) Human Tagged ORF Clone Lentiviral Particle
RC228786L3V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (Myc-DDK-tagged)-Human carbonic anhydrase I (CA1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001164830) Human Tagged ORF Clone Lentiviral Particle
RC228786L4V

USD 820.00

6 Weeks

Lenti ORF particles, CA1 (mGFP-tagged)-Human carbonic anhydrase I (CA1), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carbonic Anhydrase I (CA1) (NM_001291968) Human Tagged ORF Clone
RC236064

USD 420.00

2 Weeks

CA1 (myc-DDK-tagged) - Human carbonic anhydrase I (CA1), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001291967) Human Tagged ORF Clone
RC236477

USD 420.00

2 Weeks

CA1 (myc-DDK-tagged) - Human carbonic anhydrase I (CA1), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001128829) Human Tagged ORF Clone
RG225348

USD 460.00

3 Weeks

CA1 (GFP-tagged) - Human carbonic anhydrase I (CA1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001128830) Human Tagged ORF Clone
RG225350

USD 460.00

3 Weeks

CA1 (GFP-tagged) - Human carbonic anhydrase I (CA1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001128831) Human Tagged ORF Clone
RG225351

USD 460.00

3 Weeks

CA1 (GFP-tagged) - Human carbonic anhydrase I (CA1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) (NM_001164830) Human Tagged ORF Clone
RG228786

USD 460.00

3 Weeks

CA1 (GFP-tagged) - Human carbonic anhydrase I (CA1), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA344346

USD 475.00

5 Days

Rabbit Polyclonal Anti-CA1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CA1 antibody: synthetic peptide directed towards the N terminal of human CA1. Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS
CA1 (Erythrocytes) Rabbit Polyclonal Antibody
AP21225AF-N

USD 240.00

2 Weeks

CA1 (Erythrocytes) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Carbonic Anhydrase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
CA1 (Erythrocytes) Rabbit Polyclonal Antibody
AP21225BT-N

USD 410.00

2 Weeks

CA1 (Erythrocytes) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Carbonic Anhydrase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
CA1 (Erythrocytes) Rabbit Polyclonal Antibody
AP21225PU-N

USD 550.00

2 Weeks

CA1 (Erythrocytes) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Carbonic Anhydrase isolated and purified from Bovine Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) (Erythrocytes) Rabbit Polyclonal Antibody
AP21226AF-N

USD 240.00

2 Weeks

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) (Erythrocytes) Rabbit Polyclonal Antibody
AP21226BT-N

USD 410.00

2 Weeks

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) (Erythrocytes) Rabbit Polyclonal Antibody
AP21226PU-N

USD 550.00

2 Weeks

Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Immunogen Carbonic Anhydrase I isolated and purified from Human Erythrocytes.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA326896

USD 275.00

In Stock

Rabbit anti-CA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CA1
Carbonic anhydrase 1 (1-261, His-tag) Human Protein
AR51996PU-N

USD 415.00

2 Weeks

Carbonic anhydrase 1 (1-261, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Carbonic anhydrase 1 (1-261, His-tag) Human Protein
AR51996PU-S

USD 190.00

2 Weeks

Carbonic anhydrase 1 (1-261, His-tag) human protein, 20 µg

Tag His-tag
Expression Host E. coli
Carbonic Anhydrase I (CA1) (NM_001738) Human Untagged Clone
SC321710

USD 310.00

In Stock

CA1 (untagged)-Human carbonic anhydrase I (CA1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Carbonic Anhydrase I (CA1) Rabbit Polyclonal Antibody
TA313537

USD 345.00

In Stock

Rabbit polyclonal anti-CA1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA1.
Carbonic Anhydrase I (CA1) (166-176) Goat Polyclonal Antibody
AP23069PU-N

USD 440.00

2 Weeks

Carbonic Anhydrase I (CA1) (166-176) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from an internal region of human CA1 / Carbonic Anhydrase I (NP_001729.1)