Products

cDNA Clones (45)
Proteins (19)
RNAi (13)
Gene Expression (8)
Antibodies (5)
Assay Kits (2)
Jump to Filters
View as table Download
CD200 (NM_001004196) Human Tagged ORF Clone Lentiviral Particle
RC217941L2V

USD 1,020.00

2 Weeks

Lenti ORF particles, CD200 (mGFP-tagged) - Human CD200 molecule (CD200), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD200 (NM_005944) Human Tagged ORF Clone
RC206356

USD 420.00

In Stock

CD200 (Myc-DDK-tagged)-Human CD200 molecule (CD200), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD200 (NM_005944) Human Tagged ORF Clone Lentiviral Particle
RC206356L3V

USD 1,020.00

3 Weeks

Lenti ORF particles, CD200 (Myc-DDK tagged) - Human CD200 molecule (CD200), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_001004196) Human Tagged ORF Clone
RC217941

USD 420.00

In Stock

CD200 (Myc-DDK-tagged)-Human CD200 molecule (CD200), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CD200 (NM_005944) Human Untagged Clone
SC108879

USD 310.00

In Stock

CD200 (untagged)-Human CD200 molecule (CD200), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cd200 (NM_010818) Mouse Tagged ORF Clone
MR203755

USD 420.00

In Stock

Cd200 (Myc-DDK-tagged) - Mouse CD200 antigen (Cd200)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD200 (NM_005944) Human Tagged ORF Clone
RG206356

USD 460.00

In Stock

CD200 (GFP-tagged) - Human CD200 molecule (CD200), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD200 (NM_005944) Human Tagged ORF Clone Lentiviral Particle
RC206356L1V

USD 820.00

3 Weeks

Lenti ORF particles, CD200 (Myc-DDK tagged) - Human CD200 molecule (CD200), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CD200 (NM_005944) Human Tagged ORF Clone Lentiviral Particle
RC206356L2V

USD 820.00

6 Weeks

Lenti ORF particles, CD200 (mGFP-tagged) - Human CD200 molecule (CD200), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Cd200 (NM_010818) Mouse Tagged ORF Clone
MG203755

USD 460.00

In Stock

Cd200 (GFP-tagged) - Mouse Cd200 antigen (Cd200)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD200 (NM_001004196) Human Tagged ORF Clone
RG217941

USD 460.00

In Stock

CD200 (GFP-tagged) - Human CD200 molecule (CD200), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cd200 (BC019172) Mouse Tagged ORF Clone
MR201060

USD 68.00

USD 330.00

In Stock

Cd200 (Myc-DDK-tagged) - Mouse Cd200 antigen (cDNA clone MGC:29086 IMAGE:5003655)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cd200 (NM_031518) Rat Tagged ORF Clone
RR206783

USD 420.00

In Stock

Cd200 (Myc-DDK-tagged ORF) - Rat Cd200 molecule (Cd200), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD200 Human Gene Knockout Kit (CRISPR)
KN406356

USD 1,290.00

2 Weeks

CD200 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN406356 is the updated version of KN206356.
Cd200 Mouse Gene Knockout Kit (CRISPR)
KN502874

USD 1,290.00

2 Weeks

Cd200 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502874 is the updated version of KN302874.
Cd200 (BC019172) Mouse Tagged ORF Clone
MG201060

USD 300.00

3 Weeks

Cd200 (GFP-tagged) - Mouse Cd200 antigen (cDNA clone MGC:29086 IMAGE:5003655)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cd200 (BC019172) Mouse Tagged ORF Clone
MR201060L3

USD 500.00

3 Weeks

Lenti ORF clone of Cd200 (Myc-DDK-tagged) - Mouse Cd200 antigen (cDNA clone MGC:29086 IMAGE:5003655)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (BC019172) Mouse Tagged ORF Clone Lentiviral Particle
MR201060L3V

USD 700.00

6 Weeks

Lenti ORF particles, Cd200 (Myc-DDK-tagged) - Mouse Cd200 antigen (cDNA clone MGC:29086 IMAGE:5003655), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (BC019172) Mouse Tagged ORF Clone
MR201060L4

USD 500.00

3 Weeks

Lenti ORF clone of Cd200 (mGFP-tagged) - Mouse Cd200 antigen (cDNA clone MGC:29086 IMAGE:5003655)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (BC019172) Mouse Tagged ORF Clone Lentiviral Particle
MR201060L4V

USD 700.00

6 Weeks

Lenti ORF particles, Cd200 (GFP-tagged) - Mouse Cd200 antigen (cDNA clone MGC:29086 IMAGE:5003655), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (NM_010818) Mouse Tagged ORF Clone
MR203755L4

USD 620.00

3 Weeks

Lenti ORF clone of Cd200 (mGFP-tagged) - Mouse CD200 antigen (Cd200)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_005944) Human Tagged ORF Clone
RC206356L3

USD 620.00

In Stock

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_005944) Human Tagged ORF Clone
RC206356L4

USD 620.00

In Stock

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_005944) Human Tagged ORF Clone Lentiviral Particle
RC206356L4V

USD 820.00

3 Weeks

Lenti ORF particles, CD200 (mGFP-tagged) - Human CD200 molecule (CD200), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_001004196) Human Tagged ORF Clone
RC217941L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_001004196) Human Tagged ORF Clone
RC217941L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD200 (NM_001004196) Human Tagged ORF Clone Lentiviral Particle
RC217941L4V

USD 820.00

7 Weeks

Lenti ORF particles, CD200 (mGFP-tagged) - Human CD200 molecule (CD200), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (NM_031518) Rat Tagged ORF Clone
RR206783L3

USD 640.00

4 Weeks

Lenti ORF clone of Cd200 (Myc-DDK-tagged ORF) - Rat Cd200 molecule (Cd200), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (NM_031518) Rat Tagged ORF Clone
RR206783L4

USD 700.00

4 Weeks

Lenti ORF clone of Cd200 (mGFP-tagged ORF) - Rat Cd200 molecule (Cd200), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cd200 (NM_010818) Mouse Untagged Clone
MC202690

USD 210.00

In Stock

Cd200 (untagged) - Mouse CD200 antigen (Cd200), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Cd200 (NM_031518) Rat Untagged Clone
RN206783

USD 420.00

In Stock

Cd200 (untagged ORF) - Rat Cd200 molecule (Cd200), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CD200 (NM_005944) Human Tagged ORF Clone
RC206356L1

USD 768.00

In Stock

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CD200 (NM_001004196) Human Tagged ORF Clone
RC217941L2

USD 768.00

In Stock

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cd200 Rat Monoclonal Antibody [Clone ID: OX-90]
TA363845

USD 470.00

2 Weeks

CD200 (OX-2 Antigen), rat anti mouse, clone OX-90

Applications ELISA, IHC
Reactivities Mouse
Conjugation Unconjugated
Cd200 Mouse shRNA Plasmid (Locus ID 17470)
TG513902

USD 715.00

In Stock

Cd200 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Cd200 (BC051984) Mouse Untagged Clone
MC206019

USD 210.00

In Stock

Cd200 (untagged) - Mouse Cd200 antigen (cDNA clone MGC:62285 IMAGE:5707683), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
CD200 (NM_005944) Human Tagged ORF Clone
RC206356L2

USD 620.00

3 Weeks

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CD200 (NM_001004196) Human Tagged ORF Clone
RC217941L1

USD 620.00

3 Weeks

Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CD200 (NM_001004196) Human Untagged Clone
SC300613

USD 660.00

In Stock

CD200 (untagged)-Human CD200 molecule (CD200), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CD200 Human siRNA Oligo Duplex (Locus ID 4345)
SR302950

USD 430.00

In Stock

CD200 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Cd200 Mouse siRNA Oligo Duplex (Locus ID 17470)
SR403103

USD 430.00

In Stock

Cd200 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

CD200 Rabbit Polyclonal Antibody
TA343315

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD200 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
CD200 CytoSection
TS406356P5

USD 978.00

In Stock

Transient overexpression of CD200 (NM_005944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack