Germany
Japan
United Kingdom
China
CORO1A (Myc-DDK-tagged)-Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Coro1a (Myc-DDK-tagged) - Mouse coronin, actin binding protein 1A (Coro1a)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human coronin, actin binding protein, 1A (CORO1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, CORO1A (Myc-DDK tagged) - Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, CORO1A (mGFP-tagged) - Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CORO1A (GFP-tagged) - Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Coro1a (myc-DDK-tagged) - Mouse coronin, actin binding protein 1A (Coro1a), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CORO1A (Myc-DDK tagged) - Homo sapiens coronin, actin binding protein, 1A (CORO1A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CORO1A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410753 is the updated version of KN210753.
Coro1a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503702 is the updated version of KN303702.
Coro1a (GFP-tagged) - Mouse coronin, actin binding protein 1A (Coro1a)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Coro1a (Myc-DDK-tagged) - Mouse coronin, actin binding protein 1A (Coro1a)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coro1a (Myc-DDK-tagged) - Mouse coronin, actin binding protein 1A (Coro1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Coro1a (mGFP-tagged) - Mouse coronin, actin binding protein 1A (Coro1a)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coro1a (GFP-tagged) - Mouse coronin, actin binding protein 1A (Coro1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, CORO1A (Myc-DDK tagged) - Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, CORO1A (mGFP-tagged) - Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CORO1A (GFP-tagged) - Homo sapiens coronin, actin binding protein, 1A (CORO1A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Coro1a (Myc-DDK-tagged ORF) - Rat coronin, actin binding protein 1A (Coro1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Coro1a (Myc-DDK-tagged ORF) - Rat coronin, actin binding protein 1A (Coro1a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coro1a (Myc-DDK-tagged ORF) - Rat coronin, actin binding protein 1A (Coro1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Coro1a (mGFP-tagged ORF) - Rat coronin, actin binding protein 1A (Coro1a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Coro1a (GFP-tagged ORF) - Rat coronin, actin binding protein 1A (Coro1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CORO1A antibody: synthetic peptide directed towards the N terminal of human CORO1A. Synthetic peptide located within the following region: MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALI |
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CORO1A antibody: synthetic peptide directed towards the C terminal of human CORO1A. Synthetic peptide located within the following region: ELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLD |
Transient overexpression lysate of coronin, actin binding protein, 1A (CORO1A)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CORO1A (untagged)-Human coronin, actin binding protein, 1A (CORO1A), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal CORO1A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CORO1A. |
Coronin 1a (CORO1A) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a sequence shared between the Mouse (NP_034028) and Human (NP_009005) gene products. After repeated injections, immune eggs were collected, the IgY fractions were purified from the yolks. |
CORO1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Coro1a (untagged) - Mouse coronin, actin binding protein 1A (Coro1a), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Human cDNA FLJ40645 fis, clone THYMU2017215, moderately similar to CORONIN-LIKE PROTEIN P57
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Polyclonal Antibody against Coronin 1 / TACO
| Applications | WB |
| Reactivities | HumannMouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRLDRLEETVQAK, from the C Terminus of the protein sequence according to NP_009005.1. |
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CORO1A Antibody: synthetic peptide directed towards the C terminal of human CORO1A. Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK |
Rabbit Polyclonal Anti-CORO1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CORO1A Antibody: synthetic peptide directed towards the middle region of human CORO1A. Synthetic peptide located within the following region: SVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVS |
CORO1A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
CORO1A CRISPRa kit - CRISPR gene activation of human coronin 1A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Coro1a CRISPRa kit - CRISPR gene activation of mouse coronin, actin binding protein 1A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CORO1A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CORO1A
Coro1a (untagged) - Mouse coronin, actin binding protein 1A (Coro1a), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qPCR primer pairs and template standards against Mus musculus gene Coro1a
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Coro1a
CORO1A MS Standard C13 and N15-labeled recombinant protein (NP_009005)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Coro1a (untagged ORF) - Rat coronin, actin binding protein 1A (Coro1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- CORO1A