Products

cDNA Clones (46)
RNAi (14)
Gene Expression (11)
Proteins (7)
Antibodies (4)
Jump to Filters
View as table Download
CRBN (NM_016302) Human Tagged ORF Clone
RC209794

USD 590.00

In Stock

CRBN (Myc-DDK-tagged)-Human cereblon (CRBN), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CRBN (NM_016302) Human Tagged ORF Clone
RG209794

USD 460.00

In Stock

CRBN (GFP-tagged) - Human cereblon (CRBN), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (BC086488) Mouse Tagged ORF Clone
MR206875

USD 260.00

In Stock

Crbn (Myc-DDK-tagged) - Mouse cereblon (cDNA clone MGC:103113 IMAGE:30443656)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CRBN (NM_016302) Human Tagged ORF Clone Lentiviral Particle
RC209794L2V

USD 820.00

3 Weeks

Lenti ORF particles, CRBN (mGFP-tagged) - Human cereblon (CRBN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CRBN (NM_016302) Human Tagged ORF Clone Lentiviral Particle
RC209794L1V

USD 820.00

3 Weeks

Lenti ORF particles, CRBN (Myc-DDK tagged) - Human cereblon (CRBN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Crbn (NM_175357) Mouse Tagged ORF Clone
MR225531L3

USD 670.00

In Stock

Lenti ORF clone of Crbn (Myc-DDK-tagged) - Mouse cereblon (Crbn), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN Human Gene Knockout Kit (CRISPR)
KN409794

USD 1,290.00

2 Weeks

CRBN - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409794 is the updated version of KN209794.
Crbn Mouse Gene Knockout Kit (CRISPR)
KN503802

USD 1,290.00

2 Weeks

Crbn - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503802 is the updated version of KN303802.
Crbn (BC086488) Mouse Tagged ORF Clone
MG206875

USD 290.00

3 Weeks

Crbn (GFP-tagged) - Mouse cereblon (cDNA clone MGC:103113 IMAGE:30443656)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (NM_175357) Mouse Tagged ORF Clone
MG225531

USD 520.00

3 Weeks

Crbn (GFP-tagged) - Mouse cereblon (Crbn) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (NM_021449) Mouse Tagged ORF Clone
MG225532

USD 520.00

3 Weeks

Crbn (GFP-tagged) - Mouse cereblon (Crbn) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (BC086488) Mouse Tagged ORF Clone
MR206875L3

USD 460.00

3 Weeks

Lenti ORF clone of Crbn (Myc-DDK-tagged) - Mouse cereblon (cDNA clone MGC:103113 IMAGE:30443656)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (BC086488) Mouse Tagged ORF Clone Lentiviral Particle
MR206875L3V

USD 660.00

6 Weeks

Lenti ORF particles, Crbn (Myc-DDK-tagged) - Mouse cereblon (cDNA clone MGC:103113 IMAGE:30443656), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (BC086488) Mouse Tagged ORF Clone
MR206875L4

USD 460.00

3 Weeks

Lenti ORF clone of Crbn (mGFP-tagged) - Mouse cereblon (cDNA clone MGC:103113 IMAGE:30443656)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (BC086488) Mouse Tagged ORF Clone Lentiviral Particle
MR206875L4V

USD 660.00

6 Weeks

Lenti ORF particles, Crbn (GFP-tagged) - Mouse cereblon (cDNA clone MGC:103113 IMAGE:30443656), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_175357) Mouse Tagged ORF Clone
MR225531

USD 470.00

3 Weeks

Crbn (Myc-DDK-tagged) - Mouse cereblon (Crbn), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (NM_175357) Mouse Tagged ORF Clone Lentiviral Particle
MR225531L3V

USD 870.00

3 Weeks

Lenti ORF particles, Crbn (Myc-DDK-tagged) - Mouse cereblon (Crbn), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_175357) Mouse Tagged ORF Clone
MR225531L4

USD 670.00

3 Weeks

Lenti ORF clone of Crbn (mGFP-tagged) - Mouse cereblon (Crbn), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_175357) Mouse Tagged ORF Clone Lentiviral Particle
MR225531L4V

USD 870.00

6 Weeks

Lenti ORF particles, Crbn (GFP-tagged) - Mouse cereblon (Crbn), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_021449) Mouse Tagged ORF Clone
MR225532

USD 470.00

2 Weeks

Crbn (Myc-DDK-tagged) - Mouse cereblon (Crbn), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (NM_021449) Mouse Tagged ORF Clone
MR225532L3

USD 670.00

3 Weeks

Lenti ORF clone of Crbn (Myc-DDK-tagged) - Mouse cereblon (Crbn), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_021449) Mouse Tagged ORF Clone Lentiviral Particle
MR225532L3V

USD 870.00

6 Weeks

Lenti ORF particles, Crbn (Myc-DDK-tagged) - Mouse cereblon (Crbn), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_021449) Mouse Tagged ORF Clone
MR225532L4

USD 670.00

3 Weeks

Lenti ORF clone of Crbn (mGFP-tagged) - Mouse cereblon (Crbn), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_021449) Mouse Tagged ORF Clone Lentiviral Particle
MR225532L4V

USD 870.00

6 Weeks

Lenti ORF particles, Crbn (GFP-tagged) - Mouse cereblon (Crbn), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_016302) Human Tagged ORF Clone
RC209794L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cereblon (CRBN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_016302) Human Tagged ORF Clone Lentiviral Particle
RC209794L3V

USD 820.00

7 Weeks

Lenti ORF particles, CRBN (Myc-DDK tagged) - Human cereblon (CRBN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_016302) Human Tagged ORF Clone
RC209794L4

USD 620.00

In Stock

Lenti ORF clone of Human cereblon (CRBN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_016302) Human Tagged ORF Clone Lentiviral Particle
RC209794L4V

USD 820.00

3 Weeks

Lenti ORF particles, CRBN (mGFP-tagged) - Human cereblon (CRBN), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_001173482) Human Tagged ORF Clone
RC230087

USD 420.00

3 Weeks

CRBN (Myc-DDK-tagged)-Human cereblon (CRBN), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CRBN (NM_001173482) Human Tagged ORF Clone
RC230087L3

USD 620.00

8 Weeks

Lenti-ORF clone of CRBN (Myc-DDK-tagged)-Human cereblon (CRBN), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_001173482) Human Tagged ORF Clone
RC230087L4

USD 620.00

8 Weeks

Lenti-ORF clone of CRBN (mGFP-tagged)-Human cereblon (CRBN), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_001173482) Human Tagged ORF Clone
RG230087

USD 460.00

3 Weeks

CRBN (GFP-tagged) - Human cereblon (CRBN), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (NM_001015003) Rat Tagged ORF Clone
RR203397

USD 600.00

4 Weeks

Crbn (Myc-DDK-tagged ORF) - Rat cereblon (Crbn), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Crbn (NM_001015003) Rat Tagged ORF Clone
RR203397L3

USD 800.00

9 Weeks

Lenti ORF clone of Crbn (Myc-DDK-tagged ORF) - Rat cereblon (Crbn), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Crbn (NM_001015003) Rat Tagged ORF Clone
RR203397L4

USD 890.00

9 Weeks

Lenti ORF clone of Crbn (mGFP-tagged ORF) - Rat cereblon (Crbn), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CRBN (NM_016302) Human Tagged Lenti ORF Clone
RC209794L1

USD 768.00

In Stock

Lenti ORF clone of Human cereblon (CRBN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CRBN Rabbit Polyclonal Antibody
TA349125

USD 484.00

5 Days

Rabbit Polyclonal Anti-LIMA1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen LIMA1 antibody was raised against an 18 amino acid peptide near the amino terminus of human LIMA1
CRBN Human shRNA Plasmid Kit (Locus ID 51185)
TG305228

USD 715.00

In Stock

CRBN - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
CRBN (NM_016302) Human Tagged Lenti ORF Clone
RC209794L2

USD 768.00

In Stock

Lenti ORF clone of Human cereblon (CRBN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CRBN (NM_016302) Human Over-expression Lysate
LC414073

USD 121.00

In Stock

CRBN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CRBN Human siRNA Oligo Duplex (Locus ID 51185)
SR309603

USD 430.00

In Stock

CRBN (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

CRBN Rabbit Polyclonal Antibody
TA345038

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-CRBN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRBN antibody: synthetic peptide directed towards the N terminal of human CRBN. Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
CRBN (NM_016302) Human Untagged Clone
SC127897

USD 760.00

In Stock

CRBN (untagged)-Human cereblon (CRBN), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC127897 is the updated version of SC125420.
CRBN Human qPCR Primer Pair (NM_016302)
HP212108

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CRBN

Crbn Mouse shRNA Plasmid (Locus ID 58799)
TG503372

USD 715.00

In Stock

Crbn - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS