Germany
Japan
United Kingdom
China
DKK1 (Myc-DDK-tagged)-Human dickkopf homolog 1 (Xenopus laevis) (DKK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Dkk1 (Myc-DDK-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DKK1 (untagged)-Human dickkopf homolog 1 (Xenopus laevis) (DKK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, Dkk1 (GFP-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DKK1 (GFP-tagged) - Human dickkopf homolog 1 (Xenopus laevis) (DKK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Dkk1 (Myc-DDK-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DKK1 (Myc-DDK tagged) - Human dickkopf homolog 1 (Xenopus laevis) (DKK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, DKK1 (mGFP-tagged) - Human dickkopf homolog 1 (Xenopus laevis) (DKK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Purified recombinant protein of Human dickkopf homolog 1 (Xenopus laevis) (DKK1).
| Tag | Tag Free |
| Expression Host | HEK293 |
Dkk1 (GFP-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dkk1 (Myc-DDK-tagged ORF) - Rat dickkopf homolog 1 (Xenopus laevis) (Dkk1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dkk1 (mGFP-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
DKK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400094 is the updated version of KN200094.
Dkk1 (untagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Dkk1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504599 is the updated version of KN304599.
Lenti ORF clone of Dkk1 (Myc-DDK-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dkk1 (Myc-DDK-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, Dkk1 (GFP-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, DKK1 (Myc-DDK tagged) - Human dickkopf homolog 1 (Xenopus laevis) (DKK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, DKK1 (mGFP-tagged) - Human dickkopf homolog 1 (Xenopus laevis) (DKK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dkk1 (Myc-DDK-tagged ORF) - Rat dickkopf homolog 1 (Xenopus laevis) (Dkk1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dkk1 (Myc-DDK-tagged ORF) - Rat dickkopf homolog 1 (Xenopus laevis) (Dkk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dkk1 (mGFP-tagged ORF) - Rat dickkopf homolog 1 (Xenopus laevis) (Dkk1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dkk1 (GFP-tagged ORF) - Rat dickkopf homolog 1 (Xenopus laevis) (Dkk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Lenti ORF clone of Dkk1 (mGFP-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DKK1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
DKK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
DKK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Dkk1
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody: synthetic peptide directed towards the C terminal of human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
DKK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of dickkopf homolog 1 (Xenopus laevis) (DKK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DKK1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Lenti ORF clone of Dkk1 (Myc-DDK-tagged) - Mouse dickkopf homolog 1 (Xenopus laevis) (Dkk1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Dkk1 (untagged ORF) - Rat dickkopf homolog 1 (Xenopus laevis) (Dkk1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human dickkopf homolog 1 (Xenopus laevis) (DKK1), full length, with C-terminal DDK tag, expressed in sf9, 20ug
| Tag | C-DDK |
| Expression Host | Sf9 |
Dkk1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Purified recombinant protein of Human dickkopf homolog 1 (Xenopus laevis) (DKK1),Thr32-End, with N-terminal His tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
DKK1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 64~93 amino acids from the N-terminal region of Human Dickkopf-1. |
qSTAR qPCR primer pairs against Homo sapiens gene DKK1
Rabbit Polyclonal Anti-DKK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DKK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DKK1. Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD |
Rabbit Polyclonal Anti-DKK1 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DKK1 antibody was raised against synthetic 15 amino acid peptide from 1st cytoplasmic domain of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-DKK1 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DKK1 antibody was raised against synthetic 16 amino acid peptide from internal region of human DKK1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Baboon, Monkey, Marmoset, Bat, Horse, Pig (100%); Galago, Sheep, Goat, Elephant, Bovine, Rabbit, Guinea pig (94%); Hamster, Panda, Dog (88%). |
Rabbit Polyclonal Anti-DKK1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DKK1 antibody was raised against synthetic 16 amino acid peptide from N-terminus of human DKK1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Horse, Pig (100%); Gibbon, Mouse, Rat, Bat, Elephant (94%); Bovine, Hamster (88%); Panda, Rabbit (81%). |
Rabbit Polyclonal Anti-DKK1 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DKK1 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human DKK1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Baboon, Monkey, Galago (100%); Orangutan, Gibbon, Marmoset, Elephant, Bovine, Horse, Rabbit, Pig (93%); Rat, Bat (86%). |
Active filters
Target Symbol
- DKK1