Germany
Japan
United Kingdom
China
EDIL3 (Myc-DDK-tagged)-Human EGF-like repeats and discoidin I-like domains 3 (EDIL3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Edil3 (Myc-DDK-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EDIL3 (GFP-tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human EGF-like repeats and discoidin I-like domains 3 (EDIL3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, EDIL3 (Myc-DDK tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, EDIL3 (mGFP-tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
EDIL3 (myc-DDK-tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
EDIL3 (untagged)-Human EGF-like repeats and discoidin I-like domains 3 (EDIL3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
EDIL3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405282 is the updated version of KN205282.
Edil3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505001 is the updated version of KN305001.
Edil3 (GFP-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (cDNA clone MGC:73461 IMAGE:6854497)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Edil3 (GFP-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3) transcript variant 2, (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Edil3 (Myc-DDK-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Edil3 (Myc-DDK-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Edil3 (mGFP-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Edil3 (GFP-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Edil3 (Myc-DDK-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Edil3 (Myc-DDK-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Edil3 (Myc-DDK-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Edil3 (mGFP-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Edil3 (GFP-tagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, EDIL3 (Myc-DDK tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, EDIL3 (mGFP-tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of EGF-like repeats and discoidin I-like domains 3 (EDIL3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
EDIL3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF clone of Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
EDIL3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
EDIL3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-EDIL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDIL3 antibody: synthetic peptide directed towards the N terminal of human EDIL3. Synthetic peptide located within the following region: EPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNI |
EDIL3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
For quantitative detection of human EDIL3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for human EDIL3 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
EDIL3 CRISPRa kit - CRISPR gene activation of human EGF like repeats and discoidin domains 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Edil3 CRISPRa kit - CRISPR gene activation of mouse EGF-like repeats and discoidin I-like domains 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene EDIL3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene EDIL3
EDIL3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
EDIL3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
EDIL3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Edil3 (untagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 2, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Edil3 (untagged) - Mouse EGF-like repeats and discoidin I-like domains 3 (Edil3), transcript variant 1, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Edil3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
EDIL3 MS Standard C13 and N15-labeled recombinant protein (NP_005702)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
EDIL3 (GFP-tagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
3`UTR clone of EGF-like repeats and discoidin I-like domains 3 (EDIL3) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
EDIL3 (untagged) - Human EGF-like repeats and discoidin I-like domains 3 (EDIL3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Edil3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Active filters
Target Symbol
- EDIL3