Germany
Japan
United Kingdom
China
ELOVL5 (Myc-DDK-tagged)-Human ELOVL fatty acid elongase 5 (ELOVL5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Elovl5 (Myc-DDK-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Elovl5 (Myc-DDK-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Elovl5 (GFP-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, ELOVL5 (Myc-DDK tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ELOVL5 (mGFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ELOVL5 (myc-DDK-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409435 is the updated version of KN209435.
Elovl5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505172 is the updated version of KN305172.
Elovl5 (GFP-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Elovl5 (Myc-DDK-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Elovl5 (mGFP-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elovl5 (GFP-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ELOVL fatty acid elongase 5 (ELOVL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ELOVL5 (Myc-DDK tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ELOVL fatty acid elongase 5 (ELOVL5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ELOVL5 (mGFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 (Myc-DDK tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 (GFP-tagged) - Human ELOVL fatty acid elongase 5 (ELOVL5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 (GFP-tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 (GFP-tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ELOVL5 (GFP-tagged) - Homo sapiens ELOVL fatty acid elongase 5 (ELOVL5), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Elovl5 (Myc-DDK-tagged ORF) - Rat ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Elovl5 (Myc-DDK-tagged ORF) - Rat ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elovl5 (Myc-DDK-tagged ORF) - Rat ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Elovl5 (mGFP-tagged ORF) - Rat ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Elovl5 (GFP-tagged ORF) - Rat ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Elovl5 (Myc-DDK-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ELOVL fatty acid elongase 5 (ELOVL5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Elovl5 (Myc-DDK-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-ELOVL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK |
ELOVL5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Elovl5 (untagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (cDNA clone MGC:27526 IMAGE:4457285), complete, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ELOVL5 (untagged)-Human ELOVL fatty acid elongase 5 (ELOVL5)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Elovl5 (mGFP-tagged) - Mouse ELOVL family member 5, elongation of long chain fatty acids (yeast) (Elovl5)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human ELOVL fatty acid elongase 5 (ELOVL5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ELOVL5 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 247-277 amino acids from the C-terminal region of Human ELOVL5. |
ELOVL5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) (ELOVL5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-ELOVL5 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Panda (93%); Goat, Dog, Bat, Bovine, Rabbit, Opossum (87%); Elephant, Horse, Turkey, Chicken, Lizard (80%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Turkey, Chicken (100%); Elephant, Catfish (93%); Mouse, Rat, Dog, Hamster, Horse, Rabbit, Opossum, Platypus (87%); Bovine, Goat, Panda, Xenopus, Salmon (80%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 17 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset (100%); Gibbon, Mouse, Hamster, Elephant, Rabbit (94%); Rat, Dog, Panda (88%); Bat, Bovine, Goat (82%). |
Rabbit Polyclonal Anti-ELOVL5 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | HELO1 / ELOVL5 antibody was raised against synthetic 18 amino acid peptide from internal region of human ELOVL5. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Elephant, Rabbit (100%); Marmoset, Mouse, Dog (94%); Rat, Hamster, Panda (89%); Bat (83%). |
Elovl5 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- ELOVL5