Products

cDNA Clones (31)
Proteins (21)
RNAi (12)
Antibodies (7)
Gene Expression (7)
Jump to Filters
View as table Download
GCDH (NM_000159) Human Tagged ORF Clone
RC200473

USD 98.00

USD 560.00

In Stock

GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Gcdh (NM_008097) Mouse Tagged ORF Clone
MR229959

USD 350.00

In Stock

Gcdh (myc-DDK-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gcdh (NM_001044744) Mouse Tagged ORF Clone
MR206984

USD 350.00

In Stock

Gcdh (Myc-DDK-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GCDH (NM_013976) Human Tagged ORF Clone
RC213591

USD 420.00

In Stock

GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GCDH (NM_000159) Human Tagged ORF Clone
RG200473

USD 460.00

In Stock

GCDH (GFP-tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GCDH Human Gene Knockout Kit (CRISPR)
KN400473

USD 1,290.00

2 Weeks

GCDH - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN400473 is the updated version of KN200473.
Gcdh Mouse Gene Knockout Kit (CRISPR)
KN506358

USD 1,290.00

2 Weeks

Gcdh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506358 is the updated version of KN306358.
Gcdh (NM_008097) Mouse Tagged ORF Clone
MG206984

USD 390.00

3 Weeks

Gcdh (GFP-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gcdh (NM_001044744) Mouse Tagged ORF Clone
MR206984L3

USD 550.00

3 Weeks

Lenti ORF clone of Gcdh (Myc-DDK-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gcdh (NM_001044744) Mouse Tagged ORF Clone Lentiviral Particle
MR206984L3V

USD 750.00

6 Weeks

Lenti ORF particles, Gcdh (Myc-DDK-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gcdh (NM_001044744) Mouse Tagged ORF Clone
MR206984L4

USD 550.00

3 Weeks

Lenti ORF clone of Gcdh (mGFP-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gcdh (NM_001044744) Mouse Tagged ORF Clone Lentiviral Particle
MR206984L4V

USD 750.00

6 Weeks

Lenti ORF particles, Gcdh (GFP-tagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_000159) Human Tagged Lenti ORF Clone
RC200473L3

USD 768.00

3 Weeks

Lenti ORF clone of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_000159) Human Tagged ORF Clone Lentiviral Particle
RC200473L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, GCDH (Myc-DDK tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_000159) Human Tagged Lenti ORF Clone
RC200473L4

USD 768.00

3 Weeks

Lenti ORF clone of Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_000159) Human Tagged ORF Clone Lentiviral Particle
RC200473L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, GCDH (mGFP-tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_013976) Human Tagged ORF Clone
RC213591L3

USD 620.00

3 Weeks

Lenti-ORF clone of GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_013976) Human Tagged ORF Clone Lentiviral Particle
RC213591L3V

USD 820.00

6 Weeks

Lenti ORF particles, GCDH (Myc-DDK-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_013976) Human Tagged ORF Clone
RC213591L4

USD 620.00

3 Weeks

Lenti-ORF clone of GCDH (mGFP-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_013976) Human Tagged ORF Clone Lentiviral Particle
RC213591L4V

USD 820.00

6 Weeks

Lenti ORF particles, GCDH (mGFP-tagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_013976) Human Tagged ORF Clone
RG213591

USD 460.00

3 Weeks

GCDH (GFP-tagged) - Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gcdh (NM_001108896) Rat Tagged ORF Clone
RR213684

USD 600.00

4 Weeks

Gcdh (Myc-DDK-tagged ORF) - Rat glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gcdh (NM_001108896) Rat Tagged ORF Clone
RR213684L3

USD 800.00

8 Weeks

Lenti ORF clone of Gcdh (Myc-DDK-tagged ORF) - Rat glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gcdh (NM_001108896) Rat Tagged ORF Clone Lentiviral Particle
RR213684L3V

USD 1,030.00

12 Weeks

Lenti ORF particles, Gcdh (Myc-DDK-tagged ORF) - Rat glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gcdh (NM_001108896) Rat Tagged ORF Clone
RR213684L4

USD 890.00

8 Weeks

Lenti ORF clone of Gcdh (mGFP-tagged ORF) - Rat glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gcdh (NM_001108896) Rat Tagged ORF Clone Lentiviral Particle
RR213684L4V

USD 1,140.00

12 Weeks

Lenti ORF particles, Gcdh (GFP-tagged ORF) - Rat glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GCDH (NM_000159) Human Over-expression Lysate
LY424891

USD 396.00

In Stock

Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCDH (C-term) Rabbit Polyclonal Antibody
AP51799PU-N

USD 450.00

2 Weeks

GCDH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 335-365 amino acids from the C-terminal region of Human GCD / GCDH
GCDH (NM_013976) Human Over-expression Lysate
LC429397

USD 121.00

In Stock

GCDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCDH (NM_013976) Human Over-expression Lysate
LY429397

USD 396.00

In Stock

Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCDH (NM_000159) Human Untagged Clone
SC320175

USD 310.00

In Stock

GCDH (untagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
GCDH Rabbit Polyclonal Antibody
TA332367

USD 310.00

5 Days

Rabbit Polyclonal Anti-GCDH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the C terminal of human GCDH. Synthetic peptide located within the following region: IARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG
GCDH Rabbit Polyclonal Antibody
TA331987

USD 375.00

5 Days

Rabbit Polyclonal Anti-Gcdh Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV
GCDH Rabbit Polyclonal Antibody
TA332368

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the N terminal of human GCDH. Synthetic peptide located within the following region: SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA
GCD / GCDH (45-438, His-tag) Human Protein
AR09559PU-L

USD 1,105.00

2 Weeks

GCD / GCDH (45-438, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
GCD / GCDH (45-438, His-tag) Human Protein
AR09559PU-N

USD 415.00

2 Weeks

GCD / GCDH (45-438, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Human GCDH activation kit by CRISPRa
GA101759

USD 1,290.00

2 Weeks

GCDH CRISPRa kit - CRISPR gene activation of human glutaryl-CoA dehydrogenase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gcdh activation kit by CRISPRa
GA216071

USD 1,290.00

2 Weeks

Gcdh CRISPRa kit - CRISPR gene activation of mouse glutaryl-Coenzyme A dehydrogenase

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
GCDH Human qPCR Template Standard (NM_000159)
HK203295

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GCDH

Application Plasmid of exact quantity for transcript copy number calculation
GCDH Human qPCR Primer Pair (NM_000159)
HP200144

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GCDH

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
GCDH (NM_013976) Human Over-expression Lysate
LC415563

USD 187.00

2 Weeks

GCDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCDH (NM_000159) Human Over-expression Lysate
LC424891

USD 121.00

2 Weeks

GCDH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GCDH (NM_013976) Human Over-expression Lysate
LY415563

USD 605.00

5 Days

Transient overexpression lysate of glutaryl-Coenzyme A dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY415563 is the same product as LY429397.
Gcdh (NM_001044744) Mouse Untagged Clone
MC215885

USD 600.00

4 Weeks

Gcdh (untagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Gcdh (NM_008097) Mouse Untagged Clone
MC227748

USD 450.00

2 Weeks

Gcdh (untagged) - Mouse glutaryl-Coenzyme A dehydrogenase (Gcdh), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Gcdh Mouse qPCR Primer Pair (NM_001044744)
MP221839

USD 120.00

5 Days

qSTAR qPCR primer pairs against mus musculus gene Gcdh

GCDH (NM_000159) Human Mass Spec Standard
PH300473

USD 2,055.00

3 Weeks

GCDH MS Standard C13 and N15-labeled recombinant protein (NP_000150)

Tag C-Myc/DDK
Expression Host HEK293
Gcdh (NM_001108896) Rat Untagged Clone
RN213684

USD 600.00

4 Weeks

Gcdh (untagged ORF) - Rat glutaryl-Coenzyme A dehydrogenase (Gcdh), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GCDH (NM_013976) Human Untagged Clone
SC126971

USD 720.00

4 Weeks

GCDH (untagged)-Human glutaryl-CoA dehydrogenase (GCDH), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None