Products

cDNA Clones (22)
Proteins (13)
RNAi (12)
Gene Expression (9)
Antibodies (5)
Jump to Filters
View as table Download
Gla (NM_013463) Mouse Tagged ORF Clone
MR206655

USD 440.00

In Stock

Gla (Myc-DDK-tagged) - Mouse galactosidase, alpha (Gla)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Galactosidase alpha (GLA) (NM_000169) Human Recombinant Protein
TP301304

USD 439.00

In Stock

Recombinant protein of human galactosidase, alpha (GLA)

Tag C-Myc/DDK
Expression Host HEK293T
Galactosidase alpha (GLA) (NM_000169) Human Untagged Clone
SC319065

USD 310.00

In Stock

GLA (untagged)-Human galactosidase, alpha (GLA)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SC319065 is the updated version of SC120089.
Gla Mouse Gene Knockout Kit (CRISPR)
KN506503

USD 1,290.00

2 Weeks

Gla - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN506503 is the updated version of KN306503.
Gla (NM_013463) Mouse Tagged ORF Clone
MG206655

USD 480.00

3 Weeks

Gla (GFP-tagged) - Mouse galactosidase, alpha (Gla)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gla (NM_013463) Mouse Tagged ORF Clone
MR206655L3

USD 640.00

3 Weeks

Lenti ORF clone of Gla (Myc-DDK-tagged) - Mouse galactosidase, alpha (Gla)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gla (NM_013463) Mouse Tagged ORF Clone
MR206655L4

USD 640.00

3 Weeks

Lenti ORF clone of Gla (mGFP-tagged) - Mouse galactosidase, alpha (Gla)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gla (NM_001108820) Rat Tagged ORF Clone
RR203139

USD 420.00

4 Weeks

Gla (Myc-DDK-tagged ORF) - Rat galactosidase, alpha (Gla), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gla (NM_001108820) Rat Tagged ORF Clone
RR203139L3

USD 640.00

8 Weeks

Lenti ORF clone of Gla (Myc-DDK-tagged ORF) - Rat galactosidase, alpha (Gla), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gla (NM_001108820) Rat Tagged ORF Clone
RR203139L4

USD 700.00

8 Weeks

Lenti ORF clone of Gla (mGFP-tagged ORF) - Rat galactosidase, alpha (Gla), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GLA Human siRNA Oligo Duplex (Locus ID 2717)
SR320297

USD 430.00

In Stock

GLA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR320297 is the updated version of SR301812.
Gla (NM_013463) Mouse Untagged Clone
MC200746

USD 210.00

In Stock

Gla (untagged) - Mouse galactosidase, alpha (Gla), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
GLA Human shRNA Plasmid Kit (Locus ID 2717)
TR312761

USD 715.00

In Stock

GLA - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
E. coli Selection Ampicillin
Mammalian Cell Selection Puromycin
Galactosidase alpha (GLA) (N-term) Rabbit Polyclonal Antibody
AP17424PU-N

USD 450.00

2 Weeks

Galactosidase alpha (GLA) (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 90~120 amino acids from the N-terminal region of human GLA
Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA336243

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF
Gla Mouse shRNA Plasmid (Locus ID 11605)
TL500058

USD 946.00

2 Weeks

Gla - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol (34 ug/ml)
Mammalian Cell Selection Puromycin
Gla Mouse shRNA Lentiviral Particle (Locus ID 11605)
TL500058V

USD 1,617.00

5 Weeks

Gla - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Galactosidase alpha (GLA) Human qPCR Template Standard (NM_000169)
HK203362

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GLA

Application Plasmid of exact quantity for transcript copy number calculation
Galactosidase alpha (GLA) (NM_000169) Human Over-expression Lysate
LC400067

USD 121.00

In Stock

GLA HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
GLA Human shRNA Plasmid Kit (Locus ID 2717)
TL312761

USD 815.00

In Stock

GLA - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
Alpha-galactosidase A / GLA (32-429, His-tag) Human Protein
AR51980PU-N

USD 1,445.00

2 Weeks

Alpha-galactosidase A / GLA (32-429, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host Insect
Alpha-galactosidase A / GLA (32-429, His-tag) Human Protein
AR51980PU-S

USD 415.00

2 Weeks

Alpha-galactosidase A / GLA (32-429, His-tag) human protein, 50 µg

Tag His-tag
Expression Host Insect
Human Galactosidase alpha (GLA) activation kit by CRISPRa
GA101814

USD 1,290.00

2 Weeks

GLA CRISPRa kit - CRISPR gene activation of human galactosidase alpha

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Gla activation kit by CRISPRa
GA200124

USD 1,290.00

2 Weeks

Gla CRISPRa kit - CRISPR gene activation of mouse galactosidase, alpha

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Galactosidase alpha (GLA) Human qPCR Template Standard (NM_000169)
HK203363

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GLA

Application Plasmid of exact quantity for transcript copy number calculation
Galactosidase alpha (GLA) Human qPCR Template Standard (NM_000169)
HK203364

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GLA

Application Plasmid of exact quantity for transcript copy number calculation
Galactosidase alpha (GLA) Human qPCR Primer Pair (NM_000169)
HP200154

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GLA

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Gla Mouse qPCR Template Standard (NM_013463)
MK200487

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Gla

Application Plasmid of exact quantity for transcript copy number calculation
Gla Mouse qPCR Primer Pair (NM_013463)
MP205190

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Gla

Galactosidase alpha (GLA) (NM_000169) Human Mass Spec Standard
PH301304

USD 2,055.00

3 Weeks

GLA MS Standard C13 and N15-labeled recombinant protein (NP_000160)

Tag C-Myc/DDK
Expression Host HEK293
Gla (NM_001108820) Rat Untagged Clone
RN203139

USD 420.00

4 Weeks

Gla (untagged ORF) - Rat galactosidase, alpha (Gla), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Gla Mouse siRNA Oligo Duplex (Locus ID 11605)
SR413915

USD 430.00

2 Weeks

Gla (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Gla Rat siRNA Oligo Duplex (Locus ID 363494)
SR502853

USD 430.00

2 Weeks

Gla (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA376586

USD 220.00

3 Weeks

Galactosidase alpha (GLA) Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-429 of human Galactosidase alpha (Galactosidase alpha (GLA)) (NP_000160.1).
Modifications Unmodified
Galactosidase alpha (GLA) Rabbit Polyclonal Antibody
TA376587

USD 275.00

3 Weeks

Galactosidase alpha (GLA) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 150-429 of human Galactosidase alpha (Galactosidase alpha (GLA)) (NP_000160.1).
Modifications Unmodified