Germany
Japan
United Kingdom
China
IGF2BP3 (Myc-DDK-tagged)-Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, Igf2bp3 (Myc-DDK-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Igf2bp3 (GFP-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, IGF2BP3 (Myc-DDK tagged) - Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, IGF2BP3 (mGFP-tagged) - Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
IGF2BP3 (GFP-tagged) - Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Igf2bp3 (GFP-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Igf2bp3 (Myc-DDK-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IGF2BP3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN409597 is the updated version of KN209597.
Igf2bp3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508175 is the updated version of KN308175.
Lenti ORF clone of Igf2bp3 (Myc-DDK-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igf2bp3 (Myc-DDK-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Igf2bp3 (mGFP-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Igf2bp3 (GFP-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, IGF2BP3 (Myc-DDK tagged) - Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, IGF2BP3 (mGFP-tagged) - Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IGF2BP3 (untagged)-Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Lenti ORF clone of Igf2bp3 (mGFP-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IGF2BP3 (untagged)-Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Igf2bp3 (untagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-Igf2bp3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Igf2bp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI |
Transient overexpression lysate of insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Igf2bp3 (Myc-DDK-tagged) - Mouse insulin-like growth factor 2 mRNA binding protein 3 (Igf2bp3)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human insulin-like growth factor 2 mRNA binding protein 3 (IGF2BP3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-IF2B3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human IGF2BP3. |
IGF2BP3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Homo sapiens gene IGF2BP3
| Application | Plasmid of exact quantity for transcript copy number calculation |
IGF2BP3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Mouse Monoclonal IMP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IGF2BP3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
IGF2BP3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Carrier-free (BSA/glycerol-free) IGF2BP3 mouse monoclonal antibody,clone OTI5G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IGF2BP3 CRISPRa kit - CRISPR gene activation of human insulin like growth factor 2 mRNA binding protein 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Igf2bp3 CRISPRa kit - CRISPR gene activation of mouse insulin-like growth factor 2 mRNA binding protein 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene IGF2BP3
IGF2BP3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
IGF2BP3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
IGF2BP3 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
qPCR primer pairs and template standards against Mus musculus gene Igf2bp3
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Igf2bp3
Igf2bp3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Active filters
Target Symbol
- IGF2BP3