IL36RN (Myc-DDK-tagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL36RN (Myc-DDK-tagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
IL36RN (Myc-DDK-tagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
IL36RN (GFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
IL36RN (GFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
IL36RN - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL36RN (Myc-DDK tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, IL36RN (mGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Il36rn (Myc-DDK-tagged ORF) - Rat interleukin 1 family, member 5 (delta) (Il1f5), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Il36rn (Myc-DDK-tagged ORF) - Rat interleukin 1 family, member 5 (delta) (Il1f5), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Il36rn (Myc-DDK-tagged ORF) - Rat interleukin 1 family, member 5 (delta) (Il1f5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Il36rn (mGFP-tagged ORF) - Rat interleukin 1 family, member 5 (delta) (Il1f5), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Il36rn (GFP-tagged ORF) - Rat interleukin 1 family, member 5 (delta) (Il1f5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
IL36RN rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL36RN |
IL36RN (untagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal IL-36RN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | IL-36RN antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IL-36RN. |
Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IL36RN (untagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal Anti-Il1f5 Antibody
Applications | WB |
Reactivities | Rat |
Immunogen | The immunogen for anti-Il1f5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED |
Rabbit polyclonal Anti-IL1F5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL1F5 antibody: synthetic peptide directed towards the middle region of human IL1F5. Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
IL1F5 / IL1L1 (1-155, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
IL1F5 / IL1L1 (1-155, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
IL36RN CRISPRa kit - CRISPR gene activation of human interleukin 36 receptor antagonist
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene IL1F5
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene IL1F5
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene IL36RN
IL36RN HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IL36RN HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_775262)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
IL1F5 MS Standard C13 and N15-labeled recombinant protein (NP_036407)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Il36rn (untagged ORF) - Rat interleukin 1 family, member 5 (delta) (Il1f5), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
IL36RN (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IL36RN rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL36RN |
IL36RN rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL36RN |