Germany
Japan
United Kingdom
China
LYVE1 (Myc-DDK-tagged)-Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, Lyve1 (Myc-DDK-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Lyve1 (GFP-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, LYVE1 (Myc-DDK tagged) - Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, LYVE1 (mGFP-tagged) - Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
LYVE1 (GFP-tagged) - Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lyve1 (GFP-tagged) - Mouse extra cellular link domain-containing 1 (Xlkd1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lyve1 (Myc-DDK-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LYVE1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404609 is the updated version of KN204609.
Lyve1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509615 is the updated version of KN309615.
Lenti ORF clone of Lyve1 (Myc-DDK-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lyve1 (Myc-DDK-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lyve1 (mGFP-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lyve1 (GFP-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LYVE1 (Myc-DDK tagged) - Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, LYVE1 (mGFP-tagged) - Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lyve1 (Myc-DDK-tagged ORF) - Rat lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Lyve1 (Myc-DDK-tagged ORF) - Rat lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lyve1 (Myc-DDK-tagged ORF) - Rat lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lyve1 (mGFP-tagged ORF) - Rat lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lyve1 (GFP-tagged ORF) - Rat lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lyve1 (mGFP-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Goat Polyclonal Anti-MKRN1 (aa105-118) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MKRN1 (aa105-118) Antibody: Peptide with sequence C-RYEHSKPLKQEEAT, from the internet regoin of the protein sequence according to NP_038474.2; NP_001138597.1. |
Rabbit Polyclonal LYVE-1 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the mouse LYVE1 protein sequence (between residues 250-318). [UniProt# Q8BHC0] |
Lyve1 (untagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LYVE1 (untagged)-Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rat Anti-Mouse Lyve-1 Purified (25 ug)
| Applications | IHC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYVE1 Antibody: Peptide sequence around aa.271~275 (K-N-Q-Q-K) derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1. |
Lenti ORF clone of Lyve1 (Myc-DDK-tagged) - Mouse lymphatic vessel endothelial hyaluronan receptor 1 (Lyve1)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
LYVE1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR323268 is the updated version of SR307430.
LYVE1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
LYVE1 (untagged)-Human lymphatic vessel endothelial hyaluronan receptor 1 (LYVE1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of LYVE1 (NM_006691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
LYVE1 (271-275) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa.271~275 derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1 |
LYVE1 (271-275) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide sequence around aa.271~275 derived from Human Lymphatic vessel endothelial hyaluronic acid receptor 1 |
Rabbit Polyclonal Anti-LYVE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYVE1 antibody: synthetic peptide directed towards the N terminal of human LYVE1. Synthetic peptide located within the following region: ARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQ |
LYVE-1 (25-235, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Hi-5 insect |
LYVE-1 (25-235, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | Hi-5 insect |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI5H3
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI8E10
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI5H6
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI5D11
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LYVE1 mouse monoclonal antibody,clone OTI11C1
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
LYVE-1 mouse recombinant protein, 20 µg
| Expression Host | Insect |
Active filters
Target Symbol
- LYVE1