Germany
Japan
United Kingdom
China
MFI2 (Myc-DDK-tagged)-Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, Mfi2 (Myc-DDK-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Mfi2 (GFP-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
USD 1,210.00
3 Weeks
Lenti ORF particles, MFI2 (Myc-DDK tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 1,210.00
6 Weeks
Lenti ORF particles, MFI2 (mGFP-tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Mfi2 (Myc-DDK-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MFI2 (GFP-tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MFI2 (Myc-DDK-tagged)-Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Meltf - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN510032 is the updated version of KN310032.
Mfi2 (GFP-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mfi2 (Myc-DDK-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mfi2 (Myc-DDK-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mfi2 (mGFP-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mfi2 (GFP-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,210.00
5 Weeks
Lenti ORF particles, MFI2 (Myc-DDK tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,210.00
7 Weeks
Lenti ORF particles, MFI2 (mGFP-tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MFI2 (Myc-DDK tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MFI2 (mGFP-tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MFI2 (GFP-tagged) - Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mfi2 (Myc-DDK-tagged ORF) - Rat antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mfi2 (Myc-DDK-tagged ORF) - Rat antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mfi2 (Myc-DDK-tagged ORF) - Rat antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mfi2 (mGFP-tagged ORF) - Rat antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mfi2 (GFP-tagged ORF) - Rat antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mfi2 (Myc-DDK-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MFI2 (untagged)-Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MELTF (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Mfi2 (untagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mfi2 (mGFP-tagged) - Mouse antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Mfi2 (untagged ORF) - Rat antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (Mfi2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MELTF - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
MFI2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5 (MFI2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-MFI2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rat |
| Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Hamster, Elephant, Panda, Horse (100%); Bovine, Rabbit, Pig (93%); Chicken, Platypus (87%); Dog, Turkey, Medaka, Zebrafish (80%). |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 20 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (95%); Gibbon (85%). |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Dog, Elephant, Panda, Horse, Rabbit (100%); Bovine, Hamster, Pig (93%); Rat, Turkey, Chicken, Platypus (87%). |
MELTF CRISPRa kit - CRISPR gene activation of human melanotransferrin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene MFI2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qSTAR qPCR primer pairs against Mus musculus gene Meltf
MFI2 MS Standard C13 and N15-labeled recombinant protein (NP_005920)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Active filters
Target Symbol
- MELTF