Germany
Japan
United Kingdom
China
Nampt (Myc-DDK-tagged) - Mouse nicotinamide phosphoribosyltransferase (Nampt)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadNAMPT (untagged)-Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
NAMPT (Myc-DDK-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAMPT (GFP-tagged) - Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
NAMPT - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
PBEF1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
USD 820.00
3 Weeks
Lenti ORF particles, NAMPT (Myc-DDK-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, NAMPT (mGFP-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Nampt (GFP-tagged) - Mouse pre-B-cell colony-enhancing factor 1 (Pbef1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Nampt (Myc-DDK-tagged) - Mouse nicotinamide phosphoribosyltransferase (Nampt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
2 Weeks
Lenti ORF particles, NAMPT (mGFP-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
NAMPT - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410707 is the updated version of KN210707.
Nampt - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN510718 is the updated version of KN310718.
Lenti ORF clone of Nampt (Myc-DDK-tagged) - Mouse nicotinamide phosphoribosyltransferase (Nampt)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Nampt (mGFP-tagged) - Mouse nicotinamide phosphoribosyltransferase (Nampt)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nampt (GFP-tagged) - Mouse nicotinamide phosphoribosyltransferase (Nampt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NAMPT (Myc-DDK-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, NAMPT (Myc-DDK-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of NAMPT (mGFP-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Nampt (Myc-DDK-tagged ORF) - Rat nicotinamide phosphoribosyltransferase (Nampt), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Nampt (Myc-DDK-tagged ORF) - Rat nicotinamide phosphoribosyltransferase (Nampt), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nampt (Myc-DDK-tagged ORF) - Rat nicotinamide phosphoribosyltransferase (Nampt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Nampt (mGFP-tagged ORF) - Rat nicotinamide phosphoribosyltransferase (Nampt), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Nampt (GFP-tagged ORF) - Rat nicotinamide phosphoribosyltransferase (Nampt), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human nicotinamide phosphoribosyltransferase (NAMPT).
| Tag | Tag Free |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-PBEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH |
Nampt (untagged) - Mouse nicotinamide phosphoribosyltransferase (Nampt), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Nampt - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
NAMPT (untagged)-Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PBEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: CSYVVTNGLGINVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDL |
Nampt - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
qSTAR qPCR primer pairs against Mus musculus gene Nampt
Lenti-ORF clone of NAMPT (mGFP-tagged)-Human nicotinamide phosphoribosyltransferase (NAMPT)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Visfatin (NAMPT) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
Visfatin (NAMPT) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure E.coli derived recombinant Human Visfatin. |
qSTAR qPCR primer pairs against Homo sapiens gene NAMPT
NAMPT - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Nampt (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Nampt - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Rabbit polyclonal anti-Visfatin antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human Visfatin |
Rabbit polyclonal anti-Visfatin antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant rat Visfatin |
Rabbit Polyclonal PBEF/Visfatin/NAMPT Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 30-80 of human NAMPT/Visfatin was used as the immunogen. |
Visfatin / NAMPT (His-tag) mouse recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Visfatin / NAMPT (His-tag) mouse recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Visfatin / NAMPT (His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Active filters
Target Symbol
- NAMPT