Products

cDNA Clones (46)
Proteins (15)
Antibodies (12)
RNAi (12)
Gene Expression (8)
Jump to Filters
View as table Download
NLRX1 (NM_024618) Human Tagged ORF Clone
RC211111

USD 420.00

In Stock

NLRX1 (Myc-DDK-tagged)-Human NLR family member X1 (NLRX1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Nlrx1 (NM_178420) Mouse Tagged ORF Clone
MG211358

USD 830.00

In Stock

Nlrx1 (GFP-tagged) - Mouse NLR family member X1 (Nlrx1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NLRX1 (NM_024618) Human Tagged ORF Clone
RG211111

USD 460.00

In Stock

NLRX1 (GFP-tagged) - Human NLR family member X1 (NLRX1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nlrx1 (NM_001163742) Mouse Tagged ORF Clone
MR211358

USD 750.00

In Stock

Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NLRX1 (NM_024618) Human Tagged ORF Clone Lentiviral Particle
RC211111L1V

USD 820.00

3 Weeks

Lenti ORF particles, NLRX1 (Myc-DDK tagged) - Human NLR family member X1 (NLRX1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NLRX1 (NM_024618) Human Tagged ORF Clone Lentiviral Particle
RC211111L2V

USD 820.00

6 Weeks

Lenti ORF particles, NLRX1 (mGFP-tagged) - Human NLR family member X1 (NLRX1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NLRX1 (NM_024618) Human Tagged ORF Clone
RC211111L4

USD 620.00

In Stock

Lenti ORF clone of Human NLR family member X1 (NLRX1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NLRX1 (NM_001282143) Human Tagged ORF Clone
RC239838

USD 420.00

In Stock

NLRX1 (myc-DDK-tagged) - Human NLR family member X1 (NLRX1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NLRX1 (NM_001282144) Human Tagged ORF Clone
RC239839

USD 420.00

In Stock

NLRX1 (myc-DDK-tagged) - Human NLR family member X1 (NLRX1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NLRX1 (NM_001282358) Human Tagged ORF Clone
RC239840

USD 420.00

In Stock

NLRX1 (myc-DDK-tagged) - Human NLR family member X1 (NLRX1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NLRX1 Human Gene Knockout Kit (CRISPR)
KN411111

USD 1,290.00

2 Weeks

NLRX1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN411111 is the updated version of KN211111.
Nlrx1 Mouse Gene Knockout Kit (CRISPR)
KN511060

USD 1,290.00

2 Weeks

Nlrx1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN511060 is the updated version of KN311060.
Nlrx1 (NM_178420) Mouse Tagged ORF Clone
MG213664

USD 830.00

3 Weeks

Nlrx1 (GFP-tagged) - Mouse NLR family member X1 (Nlrx1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone
MG213673

USD 830.00

3 Weeks

Nlrx1 (GFP-tagged) - Mouse NLR family member X1 (Nlrx1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Nlrx1 (NM_001163742) Mouse Tagged ORF Clone
MR211358L3

USD 950.00

3 Weeks

Lenti ORF clone of Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163742) Mouse Tagged ORF Clone Lentiviral Particle
MR211358L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163742) Mouse Tagged ORF Clone
MR211358L4

USD 950.00

3 Weeks

Lenti ORF clone of Nlrx1 (mGFP-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163742) Mouse Tagged ORF Clone Lentiviral Particle
MR211358L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, Nlrx1 (GFP-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_178420) Mouse Tagged ORF Clone
MR213664

USD 750.00

5 Days

Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nlrx1 (NM_178420) Mouse Tagged ORF Clone
MR213664L3

USD 950.00

3 Weeks

Lenti ORF clone of Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_178420) Mouse Tagged ORF Clone Lentiviral Particle
MR213664L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_178420) Mouse Tagged ORF Clone
MR213664L4

USD 950.00

3 Weeks

Lenti ORF clone of Nlrx1 (mGFP-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_178420) Mouse Tagged ORF Clone Lentiviral Particle
MR213664L4V

USD 1,150.00

6 Weeks

Lenti ORF particles, Nlrx1 (GFP-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone
MR213673

USD 750.00

5 Days

Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone
MR213673L3

USD 950.00

5 Weeks

Lenti ORF clone of Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone Lentiviral Particle
MR213673L3V

USD 1,150.00

6 Weeks

Lenti ORF particles, Nlrx1 (Myc-DDK-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone Lentiviral Particle
MR213673L4V

USD 1,150.00

In Stock

Lenti ORF particles, Nlrx1 (GFP-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NLRX1 (NM_024618) Human Tagged ORF Clone Lentiviral Particle
RC211111L3V

USD 820.00

5 Weeks

Lenti ORF particles, NLRX1 (Myc-DDK tagged) - Human NLR family member X1 (NLRX1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001025010) Rat Tagged ORF Clone
RR206718

USD 1,310.00

6 Weeks

Nlrx1 (Myc-DDK-tagged ORF) - Rat NLR family member X1 (Nlrx1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nlrx1 (NM_001025010) Rat Tagged ORF Clone
RR206718L3

USD 1,490.00

10 Weeks

Lenti ORF clone of Nlrx1 (Myc-DDK-tagged ORF) - Rat NLR family member X1 (Nlrx1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001025010) Rat Tagged ORF Clone
RR206718L4

USD 1,640.00

10 Weeks

Lenti ORF clone of Nlrx1 (mGFP-tagged ORF) - Rat NLR family member X1 (Nlrx1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nlrx1 (NM_001163743) Mouse Tagged ORF Clone
MR213673L4

USD 1,176.00

In Stock

Lenti ORF clone of Nlrx1 (mGFP-tagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NLRX1 (NM_024618) Human Tagged ORF Clone
RC211111L1

USD 768.00

In Stock

Lenti ORF clone of Human NLR family member X1 (NLRX1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Nlrx1 (NM_178420) Mouse Untagged Clone
MC204753

USD 210.00

In Stock

Nlrx1 (untagged) - Mouse NLR family member X1 (Nlrx1), transcript variant 2, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
NLRX1 Rabbit Polyclonal Antibody
TA320016

USD 430.00

In Stock

Rabbit Polyclonal NOD5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NOD5 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human NOD5.
NLRX1 Human siRNA Oligo Duplex (Locus ID 79671)
SR312509

USD 430.00

In Stock

NLRX1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

NLRX1 (NM_024618) Human Over-expression Lysate
LY403011

USD 396.00

In Stock

Transient overexpression lysate of NLR family member X1 (NLRX1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NLRX1 (NM_024618) Human Tagged ORF Clone
RC211111L2

USD 620.00

3 Weeks

Lenti ORF clone of Human NLR family member X1 (NLRX1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
NLRX1 (NM_024618) Human Untagged Clone
SC125516

USD 760.00

In Stock

NLRX1 (untagged)-Human NLR family member X1 (NLRX1), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
Nlrx1 Mouse siRNA Oligo Duplex (Locus ID 270151)
SR421518

USD 430.00

In Stock

Nlrx1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
NLRX1 Human qPCR Primer Pair (NM_024618)
HP214902

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene NLRX1

NLRX1 (NM_024618) Human Over-expression Lysate
LC403011

USD 121.00

In Stock

NLRX1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
NLRX1 Rabbit Polyclonal Antibody
TA337151

USD 424.00

5 Days

Rabbit Polyclonal NLRX1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Equine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 580-630 of human NLRX1 was used as the immunogen for the antibody.
NLRX1 (NM_024618) Human Recombinant Protein
TP761922

USD 215.00

In Stock

Purified recombinant protein of Human NLR family member X1 (NLRX1), transcript variant 1,Glu866-Ser975, with N-terminal His-ABP tag, expressed in E. coli, 50ug

Tag N-His-ABP
Expression Host E. coli
Nlrx1 Mouse qPCR Primer Pair (NM_178420)
MP208952

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Nlrx1

NLRX1 Goat Polyclonal Antibody
TA311526

USD 375.00

5 Days

Goat Anti-NLRX1 / NOD9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NFSGETLDSTDPSN, from the internal region of the protein sequence according to NP_078894.2; NP_733840.1.
NLRX1 Rabbit Polyclonal Antibody
TA337810

USD 375.00

5 Days

Rabbit Polyclonal Anti-NLRX1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NLRX1 antibody is: synthetic peptide directed towards the N-terminal region of Human NLRX1. Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ