Products

cDNA Clones (44)
Proteins (25)
RNAi (12)
Gene Expression (8)
Antibodies (7)
Jump to Filters
View as table Download
PCYT2 (NM_001184917) Human Tagged ORF Clone
RC230021

USD 420.00

In Stock

PCYT2 (Myc-DDK-tagged)-Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PCYT2 (NM_002861) Human Tagged ORF Clone
RC203994

USD 420.00

In Stock

PCYT2 (Myc-DDK-tagged)-Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Pcyt2 (NM_024229) Mouse Tagged ORF Clone
MR206346

USD 420.00

In Stock

Pcyt2 (Myc-DDK-tagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 Human Gene Knockout Kit (CRISPR)
KN403994

USD 1,290.00

2 Weeks

PCYT2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403994 is the updated version of KN203994.
Pcyt2 Mouse Gene Knockout Kit (CRISPR)
KN512987

USD 1,290.00

2 Weeks

Pcyt2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN512987 is the updated version of KN312987.
Pcyt2 (NM_024229) Mouse Tagged ORF Clone
MG206346

USD 460.00

3 Weeks

Pcyt2 (GFP-tagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pcyt2 (NM_024229) Mouse Tagged ORF Clone
MR206346L3

USD 620.00

3 Weeks

Lenti ORF clone of Pcyt2 (Myc-DDK-tagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pcyt2 (NM_024229) Mouse Tagged ORF Clone Lentiviral Particle
MR206346L3V

USD 820.00

6 Weeks

Lenti ORF particles, Pcyt2 (Myc-DDK-tagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pcyt2 (NM_024229) Mouse Tagged ORF Clone
MR206346L4

USD 620.00

3 Weeks

Lenti ORF clone of Pcyt2 (mGFP-tagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pcyt2 (NM_024229) Mouse Tagged ORF Clone Lentiviral Particle
MR206346L4V

USD 820.00

6 Weeks

Lenti ORF particles, Pcyt2 (GFP-tagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_002861) Human Tagged ORF Clone
RC203994L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_002861) Human Tagged ORF Clone Lentiviral Particle
RC203994L3V

USD 820.00

6 Weeks

Lenti ORF particles, PCYT2 (Myc-DDK tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_002861) Human Tagged ORF Clone
RC203994L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_002861) Human Tagged ORF Clone Lentiviral Particle
RC203994L4V

USD 820.00

6 Weeks

Lenti ORF particles, PCYT2 (mGFP-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_001184917) Human Tagged ORF Clone
RC230021L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_001184917) Human Tagged ORF Clone Lentiviral Particle
RC230021L3V

USD 820.00

6 Weeks

Lenti ORF particles, PCYT2 (Myc-DDK tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_001184917) Human Tagged ORF Clone
RC230021L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_001184917) Human Tagged ORF Clone Lentiviral Particle
RC230021L4V

USD 820.00

6 Weeks

Lenti ORF particles, PCYT2 (mGFP-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_001256435) Human Tagged ORF Clone
RC233717

USD 420.00

3 Weeks

PCYT2 (Myc-DDK tagged) - Homo sapiens phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_001282203) Human Tagged ORF Clone
RC237367

USD 420.00

2 Weeks

PCYT2 (myc-DDK-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_001256433) Human Tagged ORF Clone
RC237528

USD 420.00

2 Weeks

PCYT2 (myc-DDK-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_001256434) Human Tagged ORF Clone
RC237624

USD 420.00

2 Weeks

PCYT2 (myc-DDK-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_001282204) Human Tagged ORF Clone
RC237687

USD 420.00

2 Weeks

PCYT2 (myc-DDK-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_002861) Human Tagged ORF Clone
RG203994

USD 460.00

3 Weeks

PCYT2 (GFP-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_001184917) Human Tagged ORF Clone
RG230021

USD 460.00

3 Weeks

PCYT2 (GFP-tagged) - Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PCYT2 (NM_001256435) Human Tagged ORF Clone
RG233717

USD 460.00

3 Weeks

PCYT2 (GFP-tagged) - Homo sapiens phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pcyt2 (NM_053568) Rat Tagged ORF Clone
RR202400

USD 420.00

4 Weeks

Pcyt2 (Myc-DDK-tagged ORF) - Rat phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pcyt2 (NM_053568) Rat Tagged ORF Clone
RR202400L3

USD 640.00

9 Weeks

Lenti ORF clone of Pcyt2 (Myc-DDK-tagged ORF) - Rat phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pcyt2 (NM_053568) Rat Tagged ORF Clone Lentiviral Particle
RR202400L3V

USD 850.00

13 Weeks

Lenti ORF particles, Pcyt2 (Myc-DDK-tagged ORF) - Rat phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pcyt2 (NM_053568) Rat Tagged ORF Clone
RR202400L4

USD 700.00

9 Weeks

Lenti ORF clone of Pcyt2 (mGFP-tagged ORF) - Rat phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pcyt2 (NM_053568) Rat Tagged ORF Clone Lentiviral Particle
RR202400L4V

USD 960.00

13 Weeks

Lenti ORF particles, Pcyt2 (GFP-tagged ORF) - Rat phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PCYT2 (NM_002861) Human Over-expression Lysate
LY419054

USD 396.00

5 Days

Transient overexpression lysate of phosphate cytidylyltransferase 2, ethanolamine (PCYT2)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pcyt2 (NM_024229) Mouse Untagged Clone
MC200420

USD 210.00

In Stock

Pcyt2 (untagged) - Mouse phosphate cytidylyltransferase 2, ethanolamine (Pcyt2), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
PCYT2 (NM_002861) Human Untagged Clone
SC320786

USD 760.00

In Stock

PCYT2 (untagged)-Human phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
PCYT2 Rabbit Polyclonal Antibody
TA332113

USD 310.00

5 Days

Rabbit Polyclonal Anti-PCYT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCYT2 Antibody: synthetic peptide directed towards the C terminal of human PCYT2. Synthetic peptide located within the following region: KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
PCYT2 Rabbit Polyclonal Antibody
TA332114

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCYT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCYT2 Antibody: synthetic peptide directed towards the middle region of human PCYT2. Synthetic peptide located within the following region: KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG
Pcyt2 Rabbit Polyclonal Antibody
TA335473

USD 375.00

5 Days

Rabbit Polyclonal Anti-Pcyt2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pcyt2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTK
PCYT2 (1-389, His-tag) Human Protein
AR50173PU-N

USD 845.00

2 Weeks

PCYT2 (1-389, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PCYT2 (1-389, His-tag) Human Protein
AR50173PU-S

USD 330.00

2 Weeks

PCYT2 (1-389, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli
Human PCYT2 activation kit by CRISPRa
GA103968

USD 1,290.00

2 Weeks

PCYT2 CRISPRa kit - CRISPR gene activation of human phosphate cytidylyltransferase 2, ethanolamine

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Pcyt2 activation kit by CRISPRa
GA207891

USD 1,290.00

2 Weeks

Pcyt2 CRISPRa kit - CRISPR gene activation of mouse phosphate cytidylyltransferase 2, ethanolamine

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PCYT2 Human qPCR Template Standard (NM_002861)
HK209199

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PCYT2

Application Plasmid of exact quantity for transcript copy number calculation
PCYT2 Human qPCR Primer Pair (NM_002861)
HP206475

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PCYT2

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
PCYT2 (NM_002861) Human Over-expression Lysate
LC419054

USD 121.00

2 Weeks

PCYT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCYT2 (NM_001184917) Human Over-expression Lysate
LC433021

USD 121.00

2 Weeks

PCYT2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PCYT2 (NM_001184917) Human Over-expression Lysate
LY433021

USD 396.00

5 Days

Transient overexpression lysate of phosphate cytidylyltransferase 2, ethanolamine (PCYT2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pcyt2 Mouse qPCR Template Standard (NM_024229)
MK200265

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Pcyt2

Application Plasmid of exact quantity for transcript copy number calculation
Pcyt2 Mouse qPCR Primer Pair (NM_024229)
MP210813

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Pcyt2

PCYT2 (NM_002861) Human Mass Spec Standard
PH303994

USD 2,055.00

3 Weeks

PCYT2 MS Standard C13 and N15-labeled recombinant protein (NP_002852)

Tag C-Myc/DDK
Expression Host HEK293