Products

cDNA Clones (42)
Proteins (16)
RNAi (12)
Antibodies (9)
Gene Expression (6)
Jump to Filters
View as table Download
PHPT1 (NM_014172) Human Tagged ORF Clone
RC205124

USD 98.00

USD 390.00

In Stock

PHPT1 (Myc-DDK-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PHPT1 (NM_014172) Human Tagged ORF Clone Lentiviral Particle
RC205124L1V

USD 820.00

3 Weeks

Lenti ORF particles, PHPT1 (Myc-DDK tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PHPT1 (NM_014172) Human Tagged ORF Clone Lentiviral Particle
RC205124L2V

USD 820.00

6 Weeks

Lenti ORF particles, PHPT1 (mGFP-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PHPT1 (NM_014172) Human Recombinant Protein
TP305124

USD 823.00

In Stock

Recombinant protein of human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Phpt1 (NM_029293) Mouse Tagged ORF Clone
MR200633

USD 68.00

USD 390.00

In Stock

Phpt1 (Myc-DDK-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PHPT1 (NM_014172) Human Tagged ORF Clone
RG205124

USD 460.00

In Stock

PHPT1 (GFP-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PHPT1 Human Gene Knockout Kit (CRISPR)
KN405124

USD 1,290.00

2 Weeks

PHPT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405124 is the updated version of KN205124.
Phpt1 Mouse Gene Knockout Kit (CRISPR)
KN513236

USD 1,290.00

2 Weeks

Phpt1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513236 is the updated version of KN313236.
Phpt1 (NM_029293) Mouse Tagged ORF Clone
MG200633

USD 300.00

3 Weeks

Phpt1 (GFP-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Phpt1 (NM_029293) Mouse Tagged ORF Clone
MR200633L3

USD 500.00

3 Weeks

Lenti ORF clone of Phpt1 (Myc-DDK-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Phpt1 (NM_029293) Mouse Tagged ORF Clone Lentiviral Particle
MR200633L3V

USD 700.00

6 Weeks

Lenti ORF particles, Phpt1 (Myc-DDK-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Phpt1 (NM_029293) Mouse Tagged ORF Clone
MR200633L4

USD 500.00

3 Weeks

Lenti ORF clone of Phpt1 (mGFP-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Phpt1 (NM_029293) Mouse Tagged ORF Clone Lentiviral Particle
MR200633L4V

USD 700.00

6 Weeks

Lenti ORF particles, Phpt1 (GFP-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_014172) Human Tagged ORF Clone
RC205124L3

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_014172) Human Tagged ORF Clone Lentiviral Particle
RC205124L3V

USD 820.00

5 Weeks

Lenti ORF particles, PHPT1 (Myc-DDK tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_014172) Human Tagged ORF Clone
RC205124L4

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_014172) Human Tagged ORF Clone Lentiviral Particle
RC205124L4V

USD 820.00

7 Weeks

Lenti ORF particles, PHPT1 (mGFP-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_001135861) Human Tagged ORF Clone
RC227330

USD 420.00

2 Weeks

PHPT1 (Myc-DDK-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PHPT1 (NM_001135861) Human Tagged ORF Clone
RC227330L3

USD 620.00

8 Weeks

Lenti-ORF clone of PHPT1 (Myc-DDK-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_001135861) Human Tagged ORF Clone Lentiviral Particle
RC227330L3V

USD 820.00

11 Weeks

Lenti ORF particles, PHPT1 (Myc-DDK-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_001135861) Human Tagged ORF Clone
RC227330L4

USD 620.00

8 Weeks

Lenti-ORF clone of PHPT1 (mGFP-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_001135861) Human Tagged ORF Clone Lentiviral Particle
RC227330L4V

USD 820.00

11 Weeks

Lenti ORF particles, PHPT1 (mGFP-tagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 (NM_001287343) Human Tagged ORF Clone
RC235832

USD 420.00

2 Weeks

PHPT1 (myc-DDK-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PHPT1 (NM_001287342) Human Tagged ORF Clone
RC235850

USD 420.00

2 Weeks

PHPT1 (myc-DDK-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PHPT1 (NM_001135861) Human Tagged ORF Clone
RG227330

USD 460.00

3 Weeks

PHPT1 (GFP-tagged) - Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Phpt1 (NM_001106558) Rat Tagged ORF Clone
RR210182

USD 420.00

3 Weeks

Phpt1 (Myc-DDK-tagged ORF) - Rat phosphohistidine phosphatase 1 (Phpt1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Phpt1 (NM_001106558) Rat Tagged ORF Clone
RR210182L3

USD 640.00

7 Weeks

Lenti ORF clone of Phpt1 (Myc-DDK-tagged ORF) - Rat phosphohistidine phosphatase 1 (Phpt1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Phpt1 (NM_001106558) Rat Tagged ORF Clone
RR210182L4

USD 700.00

7 Weeks

Lenti ORF clone of Phpt1 (mGFP-tagged ORF) - Rat phosphohistidine phosphatase 1 (Phpt1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Phpt1 (NM_001106558) Rat Tagged ORF Clone Lentiviral Particle
RR210182L4V

USD 960.00

11 Weeks

Lenti ORF particles, Phpt1 (GFP-tagged ORF) - Rat phosphohistidine phosphatase 1 (Phpt1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PHPT1 Rabbit Polyclonal Antibody
TA302276

USD 512.00

2 Weeks

Rabbit Polyclonal Antibody against PHPT1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 88-117 amino acids from the C-terminal region of human PHPT1.
PHPT1 (NM_014172) Human Tagged ORF Clone
RC205124L1

USD 768.00

In Stock

Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PHPT1 Rabbit Polyclonal Antibody
TA326938

USD 275.00

3 Weeks

PHPT1 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PHPT1
PHPT1 (NM_014172) Human Untagged Clone
SC108149

USD 310.00

In Stock

PHPT1 (untagged)-Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PHPT1 (NM_014172) Human Tagged ORF Clone
RC205124L2

USD 620.00

3 Weeks

Lenti ORF clone of Human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PHPT1 (N-term) Rabbit Polyclonal Antibody
AP31258PU-N

USD 440.00

2 Weeks

PHPT1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.
PHPT1 (NM_014172) Human Over-expression Lysate
LC415462

USD 121.00

In Stock

PHPT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PHPT1 (AF131857) Human Untagged Clone
SC106263

USD 660.00

In Stock

(untagged)-Human clone 24870 mRNA sequence

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PHPT1 Rabbit Polyclonal Antibody
TA302277

USD 512.00

5 Days

Rabbit Polyclonal Antibody against PHPT1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PHPT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PHPT1.
PHPT1 Rabbit Polyclonal Antibody
TA323874

USD 345.00

4 Weeks

Anti-PHPT1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Phpt1 Rabbit Polyclonal Antibody
TA334498

USD 375.00

5 Days

Rabbit Polyclonal Anti-Phpt1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Phpt1 antibody is: synthetic peptide directed towards the C-terminal region of Phpt1. Synthetic peptide located within the following region: DCECLGGGRISHQSQDRKIHVYGYSMGYGRAQHSVSTEKIKAKYPDYEVT
PHPT1 (1-125, His-tag) Human Protein
AR09689PU-L

USD 845.00

2 Weeks

PHPT1 (1-125, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
PHPT1 (1-125, His-tag) Human Protein
AR09689PU-N

USD 330.00

2 Weeks

PHPT1 (1-125, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human PHPT1 activation kit by CRISPRa
GA109220

USD 1,290.00

2 Weeks

PHPT1 CRISPRa kit - CRISPR gene activation of human phosphohistidine phosphatase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PHPT1 Human qPCR Template Standard (NM_014172)
HK205592

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PHPT1

Application Plasmid of exact quantity for transcript copy number calculation
PHPT1 Human qPCR Primer Pair (NM_014172)
HP210679

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PHPT1

Phpt1 (NM_029293) Mouse Untagged Clone
MC207752

USD 420.00

2 Weeks

Phpt1 (untagged) - Mouse phosphohistidine phosphatase 1 (Phpt1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Phpt1 Mouse qPCR Primer Pair (NM_029293)
MP210925

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Phpt1

Mouse Phpt1 (NM_029293) AAV Particle
MR200633A1V

USD 850.00

4 Weeks

AAV ORF Particles, serotype AAV-2, Phpt1 (Myc-DDK-tagged) - Mouse phosphohistidine phosphatase 1 (Phpt1), 250ul, >10^13 TU/mL

  • AAV ORF®