Products

cDNA Clones (36)
RNAi (12)
Gene Expression (7)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
PLA2G5 (NM_000929) Human Tagged ORF Clone
RC207789

USD 520.00

In Stock

PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone
MR200857

USD 68.00

USD 390.00

In Stock

Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone Lentiviral Particle
MR200857L1V

USD 700.00

6 Weeks

Lenti ORF particles, Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone Lentiviral Particle
MR200857L2V

USD 700.00

3 Weeks

Lenti ORF particles, Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Pla2g5 (NM_011110) Mouse Tagged ORF Clone
MG221639

USD 300.00

In Stock

Pla2g5 (GFP-tagged) - Mouse phospholipase A2 group V (Pla2g5) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pla2g5 (NM_017174) Rat Tagged ORF Clone
RR209824

USD 420.00

In Stock

Pla2g5 (Myc-DDK-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pla2g5 (NM_011110) Mouse Tagged ORF Clone
MR221639

USD 410.00

In Stock

Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PLA2G5 Human Gene Knockout Kit (CRISPR)
KN407789

USD 1,290.00

2 Weeks

PLA2G5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407789 is the updated version of KN207789.
Pla2g5 Mouse Gene Knockout Kit (CRISPR)
KN513394

USD 1,290.00

2 Weeks

Pla2g5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN513394 is the updated version of KN313394.
Pla2g5 (NM_011110) Mouse Tagged ORF Clone
MG200857

USD 300.00

3 Weeks

Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone
MR200857L3

USD 500.00

3 Weeks

Lenti ORF clone of Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone Lentiviral Particle
MR200857L3V

USD 700.00

7 Weeks

Lenti ORF particles, Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone
MR200857L4

USD 500.00

3 Weeks

Lenti ORF clone of Pla2g5 (mGFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone Lentiviral Particle
MR200857L4V

USD 700.00

7 Weeks

Lenti ORF particles, Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_011110) Mouse Tagged ORF Clone
MR221639L3

USD 500.00

3 Weeks

Lenti ORF clone of Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_011110) Mouse Tagged ORF Clone Lentiviral Particle
MR221639L3V

USD 700.00

6 Weeks

Lenti ORF particles, Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_011110) Mouse Tagged ORF Clone
MR221639L4

USD 500.00

3 Weeks

Lenti ORF clone of Pla2g5 (mGFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_011110) Mouse Tagged ORF Clone Lentiviral Particle
MR221639L4V

USD 700.00

6 Weeks

Lenti ORF particles, Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G5 (NM_000929) Human Tagged ORF Clone
RC207789L4

USD 720.00

In Stock

Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PLA2G5 (NM_000929) Human Tagged ORF Clone
RG207789

USD 570.00

3 Weeks

PLA2G5 (GFP-tagged) - Human phospholipase A2, group V (PLA2G5)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pla2g5 (NM_017174) Rat Tagged ORF Clone
RR209824L3

USD 640.00

4 Weeks

Lenti ORF clone of Pla2g5 (Myc-DDK-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_017174) Rat Tagged ORF Clone Lentiviral Particle
RR209824L3V

USD 850.00

8 Weeks

Lenti ORF particles, Pla2g5 (Myc-DDK-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_017174) Rat Tagged ORF Clone
RR209824L4

USD 700.00

4 Weeks

Lenti ORF clone of Pla2g5 (mGFP-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_017174) Rat Tagged ORF Clone Lentiviral Particle
RR209824L4V

USD 960.00

8 Weeks

Lenti ORF particles, Pla2g5 (GFP-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pla2g5 (NM_001122954) Mouse Tagged Lenti ORF Clone
MR200857L2

USD 624.00

In Stock

Lenti ORF clone of Pla2g5 (mGFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PLA2G5 (NM_000929) Human Tagged Lenti ORF Clone
RC207789L1

USD 888.00

In Stock

Lenti-ORF clone of PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PLA2G5 (NM_000929) Human Tagged ORF Clone
RC207789L2

USD 720.00

In Stock

Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PLA2G5 (NM_000929) Human Untagged Clone
SC119544

USD 420.00

In Stock

PLA2G5 (untagged)-Human phospholipase A2, group V (PLA2G5)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PLA2G5 Rabbit Polyclonal Antibody
TA346054

USD 475.00

5 Days

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
PLA2G5 Rabbit Polyclonal Antibody
TA346053

USD 475.00

5 Days

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
Pla2g5 (NM_001122954) Mouse Tagged ORF Clone
MR200857L1

USD 500.00

3 Weeks

Lenti ORF clone of Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Pla2g5 (NM_017174) Rat Untagged Clone
RN209824

USD 420.00

In Stock

Pla2g5 (untagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PLA2G5 (C-term) Rabbit Polyclonal Antibody
AP53325PU-N

USD 450.00

2 Weeks

PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5.
Human PLA2G5 activation kit by CRISPRa
GA103583

USD 1,290.00

2 Weeks

PLA2G5 CRISPRa kit - CRISPR gene activation of human phospholipase A2 group V

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Pla2g5 activation kit by CRISPRa
GA203268

USD 1,290.00

2 Weeks

Pla2g5 CRISPRa kit - CRISPR gene activation of mouse phospholipase A2, group V

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
PLA2G5 Human qPCR Template Standard (NM_000929)
HK208432

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PLA2G5

Application Plasmid of exact quantity for transcript copy number calculation
PLA2G5 Human qPCR Primer Pair (NM_000929)
HP200867

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PLA2G5

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Pla2g5 (NM_001122954) Mouse Untagged Clone
MC207350

USD 420.00

2 Weeks

Pla2g5 (untagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pla2g5 (NM_011110) Mouse Untagged Clone
MC209185

USD 420.00

2 Weeks

Pla2g5 (untagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Pla2g5 Mouse qPCR Primer Pair (NM_011110)
MP210949

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Pla2g5

PLA2G5 (NM_000929) Human 3' UTR Clone
SC213327

USD 560.00

4 Weeks

3`UTR clone of phospholipase A2 group V (PLA2G5) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PLA2G5 Human siRNA Oligo Duplex (Locus ID 5322)
SR303548

USD 430.00

2 Weeks

PLA2G5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Pla2g5 Mouse siRNA Oligo Duplex (Locus ID 18784)
SR402550

USD 430.00

2 Weeks

Pla2g5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Pla2g5 Rat siRNA Oligo Duplex (Locus ID 29354)
SR509537

USD 430.00

2 Weeks

Pla2g5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PLA2G5 ICC Control Block
TB407789

USD 1,170.00

4 Weeks

Transient overexpression of PLA2G5 (NM_000929) in HEK293T cells paraffin embedded controls for ICC/IHC staining