PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Pla2g5 (GFP-tagged) - Mouse phospholipase A2 group V (Pla2g5) transcript variant 2, (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Pla2g5 (Myc-DDK-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLA2G5 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Pla2g5 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pla2g5 (mGFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pla2g5 (mGFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pla2g5 (GFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLA2G5 (GFP-tagged) - Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Pla2g5 (Myc-DDK-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pla2g5 (Myc-DDK-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pla2g5 (mGFP-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Pla2g5 (GFP-tagged ORF) - Rat phospholipase A2, group V (Pla2g5), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Pla2g5 (mGFP-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of PLA2G5 (Myc-DDK-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PLA2G5 (mGFP-tagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PLA2G5 (untagged)-Human phospholipase A2, group V (PLA2G5)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PLA2G5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC |
Rabbit Polyclonal Anti-PLA2G5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW |
Lenti ORF clone of Pla2g5 (Myc-DDK-tagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Pla2g5 (untagged ORF) - Rat phospholipase A2, group V (Pla2g5), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5. |
PLA2G5 CRISPRa kit - CRISPR gene activation of human phospholipase A2 group V
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Pla2g5 CRISPRa kit - CRISPR gene activation of mouse phospholipase A2, group V
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PLA2G5
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene PLA2G5
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Pla2g5 (untagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 1, (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Pla2g5 (untagged) - Mouse phospholipase A2, group V (Pla2g5), transcript variant 2, (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Pla2g5
3`UTR clone of phospholipase A2 group V (PLA2G5) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
PLA2G5 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pla2g5 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Pla2g5 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of PLA2G5 (NM_000929) in HEK293T cells paraffin embedded controls for ICC/IHC staining