Germany
Japan
United Kingdom
China
PRKRA (Myc-DDK-tagged)-Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
PRKRA (Myc-DDK-tagged)-Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
PRKRA (Myc-DDK-tagged)-Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, PRKRA (Myc-DDK tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PRKRA (mGFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PRKRA (GFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Prkra (Myc-DDK-tagged) - Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRKRA - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400578 is the updated version of KN200578.
Prkra - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513896 is the updated version of KN313896.
Prkra (GFP-tagged) - Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prkra (Myc-DDK-tagged) - Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prkra (Myc-DDK-tagged) - Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRKRA (Myc-DDK tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, PRKRA (mGFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRKRA (Myc-DDK tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRKRA (mGFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRKRA (Myc-DDK tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PRKRA (mGFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PRKRA (GFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PRKRA (GFP-tagged) - Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Prkra (Myc-DDK-tagged ORF) - Rat protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Prkra (Myc-DDK-tagged ORF) - Rat protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prkra (Myc-DDK-tagged ORF) - Rat protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prkra (mGFP-tagged ORF) - Rat protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Prkra (GFP-tagged ORF) - Rat protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Prkra (mGFP-tagged) - Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-PRKRA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the middle region of human PRKRA. Synthetic peptide located within the following region: RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLA |
qSTAR qPCR primer pairs against Homo sapiens gene PRKRA
PRKRA (untagged)-Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
3`UTR clone of protein kinase interferon-inducible double stranded RNA dependent activator (PRKRA) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-PRKRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKRA antibody: synthetic peptide directed towards the N terminal of human PRKRA. Synthetic peptide located within the following region: MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIP |
PRKRA - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PRKRA (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
PRKRA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Prkra (untagged) - Mouse protein kinase, interferon inducible double stranded RNA dependent activator (Prkra), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of protein kinase interferon-inducible double stranded RNA dependent activator (PRKRA) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PRKRA / PACT (1-313, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
PRKRA / PACT (1-313, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
Active filters
Target Symbol
- PRKRA