Products

cDNA Clones (42)
Proteins (20)
RNAi (12)
Gene Expression (6)
Antibodies (3)
Jump to Filters
View as table Download
Trypsin (PRSS3) (NM_007343) Human Tagged ORF Clone
RC225426

USD 420.00

In Stock

PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Trypsin (PRSS3) (NM_001197098) Human Tagged ORF Clone
RC231087

USD 420.00

In Stock

PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Trypsin (PRSS3) (NM_002771) Human Tagged ORF Clone
RC210139

USD 420.00

In Stock

PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Prss3 (NM_011645) Mouse Tagged ORF Clone
MR215215

USD 68.00

USD 149.00

In Stock

Prss3 (Myc-DDK-tagged) - Mouse protease, serine, 3 (Prss3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Prss3 Mouse Gene Knockout Kit (CRISPR)
KN514031

USD 1,290.00

2 Weeks

Prss3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514031 is the updated version of KN314031.
Prss3 (NM_011645) Mouse Tagged ORF Clone
MG215215

USD 300.00

3 Weeks

Prss3 (GFP-tagged) - Mouse protease serine 3 (Prss3), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Prss3 (NM_011645) Mouse Tagged ORF Clone
MR215215L3

USD 500.00

3 Weeks

Lenti ORF clone of Prss3 (Myc-DDK-tagged) - Mouse protease, serine, 3 (Prss3)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prss3 (NM_011645) Mouse Tagged ORF Clone
MR215215L4

USD 500.00

3 Weeks

Lenti ORF clone of Prss3 (mGFP-tagged) - Mouse protease, serine, 3 (Prss3)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_002771) Human Tagged ORF Clone
RC210139L3

USD 620.00

3 Weeks

Lenti-ORF clone of PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_002771) Human Tagged ORF Clone
RC210139L4

USD 620.00

3 Weeks

Lenti-ORF clone of PRSS3 (mGFP-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_007343) Human Tagged ORF Clone
RC225426L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protease, serine, 3 (PRSS3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_007343) Human Tagged ORF Clone Lentiviral Particle
RC225426L3V

USD 820.00

6 Weeks

Lenti ORF particles, PRSS3 (Myc-DDK tagged) - Human protease, serine, 3 (PRSS3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_007343) Human Tagged ORF Clone
RC225426L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protease, serine, 3 (PRSS3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_001197098) Human Tagged ORF Clone
RC231087L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protease, serine, 3 (PRSS3), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_001197098) Human Tagged ORF Clone Lentiviral Particle
RC231087L3V

USD 820.00

6 Weeks

Lenti ORF particles, PRSS3 (Myc-DDK tagged) - Human protease, serine, 3 (PRSS3), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_001197098) Human Tagged ORF Clone
RC231087L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protease, serine, 3 (PRSS3), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_001197097) Human Tagged ORF Clone
RC231109

USD 420.00

2 Weeks

PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Trypsin (PRSS3) (NM_001197097) Human Tagged ORF Clone
RC231109L3

USD 620.00

8 Weeks

Lenti-ORF clone of PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_001197097) Human Tagged ORF Clone Lentiviral Particle
RC231109L3V

USD 820.00

11 Weeks

Lenti ORF particles, PRSS3 (Myc-DDK-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_001197097) Human Tagged ORF Clone
RC231109L4

USD 620.00

8 Weeks

Lenti-ORF clone of PRSS3 (mGFP-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_002771) Human Tagged ORF Clone
RG210139

USD 460.00

3 Weeks

PRSS3 (GFP-tagged) - Human protease, serine, 3 (PRSS3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Trypsin (PRSS3) (NM_007343) Human Tagged ORF Clone
RG225426

USD 460.00

3 Weeks

PRSS3 (GFP-tagged) - Human protease, serine, 3 (PRSS3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Trypsin (PRSS3) (NM_001197098) Human Tagged ORF Clone
RG231087

USD 460.00

3 Weeks

PRSS3 (GFP-tagged) - Human protease, serine, 3 (PRSS3), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Trypsin (PRSS3) (NM_001197097) Human Tagged ORF Clone
RG231109

USD 460.00

3 Weeks

PRSS3 (GFP-tagged) - Human protease, serine, 3 (PRSS3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Prss3 (NM_173127) Rat Tagged ORF Clone
RR214190

USD 420.00

4 Weeks

Prss3 (Myc-DDK-tagged ORF) - Rat cationic trypsinogen (LOC286911), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Prss3 (NM_173127) Rat Tagged ORF Clone
RR214190L3

USD 640.00

8 Weeks

Lenti ORF clone of Prss3 (Myc-DDK-tagged ORF) - Rat cationic trypsinogen (LOC286911), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prss3 (NM_173127) Rat Tagged ORF Clone Lentiviral Particle
RR214190L3V

USD 850.00

12 Weeks

Lenti ORF particles, Prss3 (Myc-DDK-tagged ORF) - Rat cationic trypsinogen (LOC286911), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Prss3 (NM_173127) Rat Tagged ORF Clone
RR214190L4

USD 700.00

8 Weeks

Lenti ORF clone of Prss3 (mGFP-tagged ORF) - Rat cationic trypsinogen (LOC286911), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prss3 (NM_173127) Rat Tagged ORF Clone Lentiviral Particle
RR214190L4V

USD 960.00

12 Weeks

Lenti ORF particles, Prss3 (GFP-tagged ORF) - Rat cationic trypsinogen (LOC286911), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Trypsin (PRSS3) (NM_002771) Human Untagged Clone
SC125583

USD 420.00

In Stock

PRSS3 (untagged)-Human protease, serine, 3 (PRSS3), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Trypsin (PRSS3) (Center) Rabbit Polyclonal Antibody
AP53469PU-N

USD 512.00

2 Weeks

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3
Trypsin (PRSS3) (N-term) Rabbit Polyclonal Antibody
AP53470PU-N

USD 512.00

2 Weeks

Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3
Trypsin (PRSS3) (NM_002771) Human Tagged ORF Clone
RC210139L2

USD 620.00

3 Weeks

Lenti-ORF clone of PRSS3 (mGFP-tagged)-Human protease, serine, 3 (PRSS3), transcript variant 2

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Trypsin (PRSS3) (NM_007343) Human Untagged Clone
SC318823

USD 660.00

In Stock

PRSS3 (untagged)-Human protease, serine, 3 (PRSS3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PRSS3 Human shRNA Plasmid Kit (Locus ID 5646)
TL310137

USD 815.00

In Stock

PRSS3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
PRSS3 Human siRNA Oligo Duplex (Locus ID 5646)
SR303793

USD 430.00

In Stock

PRSS3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Trypsin (PRSS3) (NM_001197098) Human Recombinant Protein
TP761093

USD 215.00

In Stock

Purified recombinant protein of Human protease, serine, 3 (PRSS3), transcript variant 4, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Trypsin (PRSS3) Rabbit Polyclonal Antibody
TA342157

USD 375.00

5 Days

Rabbit polyclonal Anti-PRSS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH
Trypsin-3 / PRSS3 (81-304, His-tag) Human Protein
AR51079PU-N

USD 845.00

2 Weeks

Trypsin-3 / PRSS3 (81-304, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Trypsin-3 / PRSS3 (81-304, His-tag) Human Protein
AR51079PU-S

USD 330.00

2 Weeks

Trypsin-3 / PRSS3 (81-304, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Trypsin-3 / PRSS3 (81-304, His-tag) Human Protein
AR51975PU-N

USD 1,105.00

2 Weeks

Trypsin-3 / PRSS3 (81-304, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host Insect