Products

cDNA Clones (41)
RNAi (12)
Proteins (10)
Antibodies (8)
Gene Expression (8)
Jump to Filters
View as table Download
SCN1B (NM_001037) Human Tagged ORF Clone
RC209565

USD 98.00

USD 390.00

In Stock

SCN1B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SCN1B (NM_199037) Human Tagged ORF Clone
RC222161

USD 420.00

In Stock

SCN1B (Myc-DDK-tagged)-Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Scn1b (NM_011322) Mouse Tagged ORF Clone
MG202467

USD 300.00

In Stock

Scn1b (GFP-tagged) - Mouse sodium channel, voltage-gated, type I, beta (Scn1b)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Scn1b (NM_011322) Mouse Tagged ORF Clone
MR202467

USD 68.00

USD 219.00

In Stock

Scn1b (Myc-DDK-tagged) - Mouse sodium channel, voltage-gated, type I, beta (Scn1b)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SCN1B (NM_001037) Human Untagged Clone
SC119540

USD 310.00

In Stock

SCN1B (untagged)-Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SCN1B (NM_001037) Human Tagged ORF Clone Lentiviral Particle
RC209565L1V

USD 820.00

3 Weeks

Lenti ORF particles, SCN1B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SCN1B (NM_001037) Human Tagged ORF Clone
RG209565

USD 460.00

In Stock

SCN1B (GFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Scn1b (NM_017288) Rat Tagged ORF Clone
RR203157

USD 420.00

In Stock

Scn1b (Myc-DDK-tagged ORF) - Rat sodium channel, voltage-gated, type I, beta (Scn1b), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SCN1B (NM_001037) Human Tagged ORF Clone Lentiviral Particle
RC209565L2V

USD 820.00

6 Weeks

Lenti ORF particles, SCN1B (mGFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone Lentiviral Particle
RC222161L1V

USD 820.00

3 Weeks

Lenti ORF particles, SCN1B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone Lentiviral Particle
RC222161L2V

USD 820.00

6 Weeks

Lenti ORF particles, SCN1B (mGFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone
RG222161

USD 460.00

In Stock

SCN1B (GFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Scn1b (NM_001271045) Rat Tagged ORF Clone
RR216073

USD 420.00

In Stock

Scn1b (myc-DDK-tagged) - Rat sodium channel, voltage-gated, type I, beta subunit (Scn1b), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SCN1B Human Gene Knockout Kit (CRISPR)
KN409565

USD 1,290.00

2 Weeks

SCN1B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409565 is the updated version of KN209565.
Scn1b Mouse Gene Knockout Kit (CRISPR)
KN515381

USD 1,290.00

2 Weeks

Scn1b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN515381 is the updated version of KN315381.
Scn1b (NM_011322) Mouse Tagged ORF Clone
MR202467L3

USD 500.00

3 Weeks

Lenti ORF clone of Scn1b (Myc-DDK-tagged) - Mouse sodium channel, voltage-gated, type I, beta (Scn1b)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_011322) Mouse Tagged ORF Clone Lentiviral Particle
MR202467L3V

USD 700.00

6 Weeks

Lenti ORF particles, Scn1b (Myc-DDK-tagged) - Mouse sodium channel, voltage-gated, type I, beta (Scn1b), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_011322) Mouse Tagged ORF Clone
MR202467L4

USD 500.00

3 Weeks

Lenti ORF clone of Scn1b (mGFP-tagged) - Mouse sodium channel, voltage-gated, type I, beta (Scn1b)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_011322) Mouse Tagged ORF Clone Lentiviral Particle
MR202467L4V

USD 700.00

6 Weeks

Lenti ORF particles, Scn1b (GFP-tagged) - Mouse sodium channel, voltage-gated, type I, beta (Scn1b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_001037) Human Tagged ORF Clone
RC209565L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_001037) Human Tagged ORF Clone Lentiviral Particle
RC209565L3V

USD 820.00

7 Weeks

Lenti ORF particles, SCN1B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_001037) Human Tagged ORF Clone
RC209565L4

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_001037) Human Tagged ORF Clone Lentiviral Particle
RC209565L4V

USD 820.00

7 Weeks

Lenti ORF particles, SCN1B (mGFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone
RC222161L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone Lentiviral Particle
RC222161L3V

USD 820.00

5 Weeks

Lenti ORF particles, SCN1B (Myc-DDK tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone
RC222161L4

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone Lentiviral Particle
RC222161L4V

USD 820.00

7 Weeks

Lenti ORF particles, SCN1B (mGFP-tagged) - Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_017288) Rat Tagged ORF Clone
RR203157L3

USD 640.00

4 Weeks

Lenti ORF clone of Scn1b (Myc-DDK-tagged ORF) - Rat sodium channel, voltage-gated, type I, beta (Scn1b), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_017288) Rat Tagged ORF Clone Lentiviral Particle
RR203157L3V

USD 850.00

8 Weeks

Lenti ORF particles, Scn1b (Myc-DDK-tagged ORF) - Rat sodium channel, voltage-gated, type I, beta (Scn1b), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_017288) Rat Tagged ORF Clone
RR203157L4

USD 700.00

4 Weeks

Lenti ORF clone of Scn1b (mGFP-tagged ORF) - Rat sodium channel, voltage-gated, type I, beta (Scn1b), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_017288) Rat Tagged ORF Clone Lentiviral Particle
RR203157L4V

USD 960.00

8 Weeks

Lenti ORF particles, Scn1b (GFP-tagged ORF) - Rat sodium channel, voltage-gated, type I, beta (Scn1b), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Scn1b (NM_001271046) Rat Tagged ORF Clone
RR215977

USD 420.00

3 Weeks

Scn1b (myc-DDK-tagged) - Rat sodium channel, voltage-gated, type I, beta subunit (Scn1b), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SCN1B (NM_199037) Human Untagged Clone
SC309816

USD 660.00

In Stock

SCN1B (untagged)-Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SCN1B (NM_199037) Human Tagged ORF Clone
RC222161L1

USD 768.00

In Stock

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SCN1B (NM_001037) Human Tagged ORF Clone
RC209565L1

USD 620.00

In Stock

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Scn1b Mouse shRNA Plasmid (Locus ID 20266)
TG501978

USD 715.00

In Stock

Scn1b - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Scn1b Rabbit Polyclonal Antibody
TA329046

USD 585.00

3 Weeks

Rabbit polyclonal Anti-NaVBeta1 (extracellular)

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKRRSETTAETFTE, corresponding to amino acid residues 43-56 of rat NavÃ?1 . Extracellular, N-terminus.
SCN1B (N-term) Rabbit Polyclonal Antibody
AP53815PU-N

USD 450.00

2 Weeks

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 70-98 amino acids from the N-terminal region of Human SCN1B
SCN1B (NM_001037) Human Tagged ORF Clone
RC209565L2

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant a, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SCN1B (NM_199037) Human Tagged ORF Clone
RC222161L2

USD 620.00

3 Weeks

Lenti ORF clone of Human sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Scn1b (NM_017288) Rat Untagged Clone
RN203157

USD 420.00

In Stock

Scn1b (untagged ORF) - Rat sodium channel, voltage-gated, type I, beta (Scn1b), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SCN1B Rabbit Polyclonal Antibody
TA338796

USD 375.00

5 Days

Rabbit Polyclonal Anti-Scn1b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF
SCN1B (N-term) Rabbit Polyclonal Antibody
AP23388PU-N

USD 405.00

2 Weeks

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human SCN1B
SCN1B (NM_199037) Human Over-expression Lysate
LY404718

USD 396.00

5 Days

Transient overexpression lysate of sodium channel, voltage-gated, type I, beta (SCN1B), transcript variant b

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SCN1B Rabbit Polyclonal Antibody
TA338513

USD 375.00

5 Days

Rabbit Polyclonal Anti-SCN1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN1B antibody: synthetic peptide directed towards the middle region of human SCN1B. Synthetic peptide located within the following region: NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
Scn1b Rat shRNA Plasmid (Locus ID 29686)
TR710079

USD 715.00

2 Weeks

Scn1b - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Human SCN1B activation kit by CRISPRa
GA104291

USD 1,290.00

2 Weeks

SCN1B CRISPRa kit - CRISPR gene activation of human sodium voltage-gated channel beta subunit 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Scn1b activation kit by CRISPRa
GA203781

USD 1,290.00

2 Weeks

Scn1b CRISPRa kit - CRISPR gene activation of mouse sodium channel, voltage-gated, type I, beta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
SCN1B Human qPCR Template Standard (NM_001037)
HK206555

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SCN1B

Application Plasmid of exact quantity for transcript copy number calculation
SCN1B Human qPCR Template Standard (NM_199037)
HK212515

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene SCN1B

Application Plasmid of exact quantity for transcript copy number calculation