Germany
Japan
United Kingdom
China
SH2D1A (Myc-DDK-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human SH2 domain protein 1A (SH2D1A), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Sh2d1a (Myc-DDK-tagged) - Mouse SH2 domain protein 1A (Sh2d1a)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Sh2d1a (Myc-DDK-tagged) - Mouse SH2 domain protein 1A (Sh2d1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, Sh2d1a (GFP-tagged) - Mouse SH2 domain protein 1A (Sh2d1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, SH2D1A (Myc-DDK tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, SH2D1A (mGFP-tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SH2D1A (GFP-tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SH2D1A (Myc-DDK-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SH2D1A - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404723 is the updated version of KN204723.
Sh2d1a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515699 is the updated version of KN315699.
Sh2d1a (GFP-tagged) - Mouse SH2 domain protein 1A (Sh2d1a), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Sh2d1a (Myc-DDK-tagged) - Mouse SH2 domain protein 1A (Sh2d1a)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sh2d1a (Myc-DDK-tagged) - Mouse SH2 domain protein 1A (Sh2d1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Sh2d1a (mGFP-tagged) - Mouse SH2 domain protein 1A (Sh2d1a)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sh2d1a (GFP-tagged) - Mouse SH2 domain protein 1A (Sh2d1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SH2D1A (Myc-DDK tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SH2D1A (mGFP-tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SH2D1A (Myc-DDK-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SH2D1A (Myc-DDK-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SH2D1A (mGFP-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SH2D1A (mGFP-tagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SH2D1A (GFP-tagged) - Human SH2 domain containing 1A (SH2D1A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Sh2d1a (Myc-DDK-tagged ORF) - Rat SH2 domain protein 1A (Sh2d1a), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Sh2d1a (Myc-DDK-tagged ORF) - Rat SH2 domain protein 1A (Sh2d1a), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sh2d1a (Myc-DDK-tagged ORF) - Rat SH2 domain protein 1A (Sh2d1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Sh2d1a (mGFP-tagged ORF) - Rat SH2 domain protein 1A (Sh2d1a), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Sh2d1a (GFP-tagged ORF) - Rat SH2 domain protein 1A (Sh2d1a), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SH2D1A (untagged)-Human SH2 domain containing 1A (SH2D1A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Sh2d1a (mGFP-tagged) - Mouse SH2 domain protein 1A (Sh2d1a)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SH2D1A - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
SH2D1A rabbit polyclonal antibody, Purified
| Applications | IP, WB |
| Reactivities | Human |
| Immunogen | Full-length recombinant SAP protein |
Lenti ORF clone of Sh2d1a (Myc-DDK-tagged) - Mouse SH2 domain protein 1A (Sh2d1a)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human SH2 domain containing 1A (SH2D1A), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
SH2D1A HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Transient overexpression lysate of SH2 domain protein 1A (SH2D1A), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Goat Polyclonal Antibody against SH2D1A / SAP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HKRYFRKIKN, from the internal region of the protein sequence according to NP_002342.1. |
Goat Polyclonal Antibody against SH2D1A/SLAM associated protein
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QYPVEKKSSARSTQ, from the internal region of the protein sequence according to NP_002342.1. |
Rabbit Polyclonal Anti-SH2D1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH2D1A antibody: synthetic peptide directed towards the C terminal of human SH2D1A. Synthetic peptide located within the following region: YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL |
Rabbit Polyclonal Anti-SH2D1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH2D1A antibody is: synthetic peptide directed towards the middle region of Human SH2D1A. Synthetic peptide located within the following region: YTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYP |
SH2D1A (1-128, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
SH2D1A (1-128, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
SH2D1A CRISPRa kit - CRISPR gene activation of human SH2 domain containing 1A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Sh2d1a CRISPRa kit - CRISPR gene activation of mouse SH2 domain containing 1A
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SH2D1A
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SH2D1A
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Active filters
Target Symbol
- SH2D1A