Products

cDNA Clones (36)
Proteins (19)
Antibodies (8)
RNAi (8)
Gene Expression (6)
Jump to Filters
View as table Download
Tpi1 (NM_009415) Mouse Tagged ORF Clone
MR203161

USD 420.00

In Stock

Tpi1 (Myc-DDK-tagged) - Mouse triosephosphate isomerase 1 (Tpi1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Tagged ORF Clone
RG202652

USD 460.00

In Stock

TPI1 (GFP-tagged) - Human triosephosphate isomerase 1 (TPI1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tpi1 Mouse Gene Knockout Kit (CRISPR)
KN518089

USD 1,290.00

2 Weeks

Tpi1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN518089 is the updated version of KN318089.
Tpi1 (NM_009415) Mouse Tagged ORF Clone
MG203161

USD 460.00

3 Weeks

Tpi1 (GFP-tagged) - Mouse triosephosphate isomerase 1 (Tpi1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Tpi1 (NM_009415) Mouse Tagged ORF Clone
MR203161L3

USD 620.00

3 Weeks

Lenti ORF clone of Tpi1 (Myc-DDK-tagged) - Mouse triosephosphate isomerase 1 (Tpi1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tpi1 (NM_009415) Mouse Tagged ORF Clone
MR203161L4

USD 620.00

3 Weeks

Lenti ORF clone of Tpi1 (mGFP-tagged) - Mouse triosephosphate isomerase 1 (Tpi1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tpi1 (NM_009415) Mouse Tagged ORF Clone Lentiviral Particle
MR203161L4V

USD 820.00

6 Weeks

Lenti ORF particles, Tpi1 (GFP-tagged) - Mouse triosephosphate isomerase 1 (Tpi1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Tagged ORF Clone Lentiviral Particle
RC202652L3V

USD 820.00

5 Weeks

Lenti ORF particles, TPI1 (Myc-DDK tagged) - Human triosephosphate isomerase 1 (TPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Tagged ORF Clone Lentiviral Particle
RC202652L4V

USD 820.00

3 Weeks

Lenti ORF particles, TPI1 (mGFP-tagged) - Human triosephosphate isomerase 1 (TPI1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_001159287) Human Tagged ORF Clone Lentiviral Particle
RC228219L3V

USD 820.00

6 Weeks

Lenti ORF particles, TPI1 (Myc-DDK-tagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_001159287) Human Tagged ORF Clone Lentiviral Particle
RC228219L4V

USD 820.00

6 Weeks

Lenti ORF particles, TPI1 (mGFP-tagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_001258026) Human Tagged ORF Clone
RC231935

USD 420.00

3 Weeks

TPI1 (Myc-DDK tagged) - Homo sapiens triosephosphate isomerase 1 (TPI1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tpi1 (NM_022922) Rat Tagged ORF Clone
RR206797

USD 420.00

4 Weeks

Tpi1 (Myc-DDK-tagged ORF) - Rat triosephosphate isomerase 1 (Tpi1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Tpi1 (NM_022922) Rat Tagged ORF Clone
RR206797L3

USD 640.00

8 Weeks

Lenti ORF clone of Tpi1 (Myc-DDK-tagged ORF) - Rat triosephosphate isomerase 1 (Tpi1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tpi1 (NM_022922) Rat Tagged ORF Clone Lentiviral Particle
RR206797L3V

USD 850.00

12 Weeks

Lenti ORF particles, Tpi1 (Myc-DDK-tagged ORF) - Rat triosephosphate isomerase 1 (Tpi1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Tpi1 (NM_022922) Rat Tagged ORF Clone
RR206797L4

USD 700.00

8 Weeks

Lenti ORF clone of Tpi1 (mGFP-tagged ORF) - Rat triosephosphate isomerase 1 (Tpi1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Tpi1 (NM_022922) Rat Tagged ORF Clone Lentiviral Particle
RR206797L4V

USD 960.00

12 Weeks

Lenti ORF particles, Tpi1 (GFP-tagged ORF) - Rat triosephosphate isomerase 1 (Tpi1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Triosephosphate isomerase (TPI1) (NM_000365) Human Untagged Clone
SC111041

USD 310.00

In Stock

TPI1 (untagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA346536

USD 475.00

5 Days

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID
Tpi1 (NM_009415) Mouse Untagged Clone
MC209570

USD 540.00

In Stock

Tpi1 (untagged) - Mouse triosephosphate isomerase 1 (Tpi1), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Triosephosphate isomerase (TPI1) Goat Polyclonal Antibody
TA302993

USD 375.00

In Stock

Goat Polyclonal Antibody against TPI1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-LKPEFVDIINAKQ, from the C Terminus of the protein sequence according to NP_000356.
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA308459

USD 415.00

5 Days

Rabbit Polyclonal antibody to Triosephosphate isomerase (triosephosphate isomerase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 187 and 249 of Triosephosphate isomerase (Uniprot ID#P60174)
Triosephosphate isomerase (TPI1) Rabbit Polyclonal Antibody
TA332565

USD 275.00

3 Weeks

Rabbit anti-TPI1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TPI1
Triosephosphate isomerase (TPI1) (NM_000365) Human Over-expression Lysate
LC424764

USD 121.00

In Stock

TPI1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Triosephosphate isomerase (TPI1) (NM_000365) Human Over-expression Lysate
LY424764

USD 396.00

5 Days

Transient overexpression lysate of triosephosphate isomerase 1 (TPI1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Triosephosphate isomerase (TPI1) (NM_000365) Human Untagged Clone
SC320334

USD 310.00

In Stock

TPI1 (untagged)-Human triosephosphate isomerase 1 (TPI1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Triosephosphate isomerase (TPI1) (C-term) Rabbit Polyclonal Antibody
AP17803PU-N

USD 450.00

2 Weeks

Triosephosphate isomerase (TPI1) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the ?-terminal region of human TPI1 Antibody (C-term)
Triosephosphate isomerase (TPI1) (N-term) Rabbit Polyclonal Antibody
AP17804PU-N

USD 450.00

2 Weeks

Triosephosphate isomerase (TPI1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human TPI1
Triosephosphate isomerase (TPI1) (1-249, His-tag) Human Protein
AR09702PU-L

USD 845.00

2 Weeks

Triosephosphate isomerase (TPI1) (1-249, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Triosephosphate isomerase (TPI1) (1-249, His-tag) Human Protein
AR09702PU-N

USD 330.00

2 Weeks

Triosephosphate isomerase (TPI1) (1-249, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human Triosephosphate isomerase (TPI1) activation kit by CRISPRa
GA104951

USD 1,290.00

2 Weeks

TPI1 CRISPRa kit - CRISPR gene activation of human triosephosphate isomerase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Tpi1 activation kit by CRISPRa
GA204423

USD 1,290.00

2 Weeks

Tpi1 CRISPRa kit - CRISPR gene activation of mouse triosephosphate isomerase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Triosephosphate isomerase (TPI1) Human qPCR Template Standard (NM_000365)
HK207534

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene TPI1

Application Plasmid of exact quantity for transcript copy number calculation
Triosephosphate isomerase (TPI1) Human qPCR Primer Pair (NM_000365)
HP200345

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene TPI1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Tpi1 Mouse qPCR Primer Pair (NM_009415)
MP217551

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Tpi1