Germany
Japan
United Kingdom
China
ULK1 (Myc-DDK-tagged)-Human unc-51-like kinase 1 (C. elegans) (ULK1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Ulk1 (Myc-DDK-tagged) - Mouse Unc-51 like kinase 1 (C. elegans) (Ulk1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ULK1 (Myc-DDK tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ULK1 (mGFP-tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ULK1 (GFP-tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ulk1 (GFP-tagged) - Mouse Unc-51 like kinase 1 (C. elegans) (Ulk1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ULK1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415643 is the updated version of KN215643.
Ulk1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN518691 is the updated version of KN318691.
Lenti ORF clone of Ulk1 (Myc-DDK-tagged) - Mouse Unc-51 like kinase 1 (C. elegans) (Ulk1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ulk1 (Myc-DDK-tagged) - Mouse Unc-51 like kinase 1 (C. elegans) (Ulk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ulk1 (mGFP-tagged) - Mouse Unc-51 like kinase 1 (C. elegans) (Ulk1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ulk1 (GFP-tagged) - Mouse Unc-51 like kinase 1 (C. elegans) (Ulk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ULK1 (Myc-DDK tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ULK1 (mGFP-tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ulk1 (Myc-DDK-tagged ORF) - Rat Unc-51 like kinase 1 (C. elegans) (Ulk1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ulk1 (Myc-DDK-tagged ORF) - Rat Unc-51 like kinase 1 (C. elegans) (Ulk1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ulk1 (Myc-DDK-tagged ORF) - Rat Unc-51 like kinase 1 (C. elegans) (Ulk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ulk1 (mGFP-tagged ORF) - Rat Unc-51 like kinase 1 (C. elegans) (Ulk1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ulk1 (GFP-tagged ORF) - Rat Unc-51 like kinase 1 (C. elegans) (Ulk1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ulk1 (untagged) - Mouse Unc-51 like kinase 1 (C. elegans) (cDNA clone MGC:63344 IMAGE:6834534), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ULK1 (untagged)-Human unc-51-like kinase 1 (C. elegans) (ULK1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ULK1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR322391 is the updated version of SR305509.
Transient overexpression lysate of unc-51-like kinase 1 (C. elegans) (ULK1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Ulk1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ulk1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
ULK1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Ulk1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
ULK1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Mouse unc-51 like kinase 1 (Ulk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
ULK1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
qSTAR qPCR primer pairs against Homo sapiens gene ULK1
qSTAR qPCR primer pairs against Mus musculus gene Ulk1
ULK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
3`UTR clone of unc-51-like kinase 1 (C. elegans) (ULK1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-ULK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
Ulk1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
ULK1 CRISPRa kit - CRISPR gene activation of human unc-51 like autophagy activating kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ulk1 CRISPRa kit - CRISPR gene activation of mouse unc-51 like kinase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
ULK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
ULK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
ULK1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Active filters
Target Symbol
- ULK1