TNFAIP3 Rabbit Polyclonal Antibody

CAT#: TA357836

TNFAIP3 Antibody

Product Images

Rabbit Anti-TNFAIP3 antibody Catalog Number: ARP61326 Formalin Fixed Paraffin Embedded Tissue: Human Colon Primary antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20x Exposure Time: 0.5-2.0sec

Specifications

Product Data

• Applications: IHC
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence LGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRP
• Specificity: Expected reactivity: Cow, Dog, Horse, Human, Mouse, Rabbit, Rat
  Homology: Cow: 77%; Dog: 77%; Horse: 85%; Human: 100%; Mouse: 83%; Rabbit: 100%; Rat: 83%
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Predicted Protein Size: 90 kDa
• Gene Name: TNF alpha induced protein 3
• Database Link:
  NP_001257436
  Entrez Gene 7128 Human
  UniProt ID P21580
• Background: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.
• Synonyms: A20; MGC104522; MGC138687; MGC138688; OTUD7C; TNFA1P2

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: NOD-like receptor signaling pathway