Germany
Japan
United Kingdom
China
alpha Synuclein (SNCA) (NM_000345) Human Mass Spec Standard
CAT#: PH310606
SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210606 |
| Predicted MW | 14.3 kDa |
| Protein Sequence |
>RC210606 representing NM_000345
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000336 |
| RefSeq Size | 1543 |
| RefSeq ORF | 420 |
| Synonyms | NACP; PARK1; PARK4; PD1 |
| Locus ID | 6622 |
| UniProt ID | P37840 |
| Cytogenetics | 4q22.1 |
| Summary | 'Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Parkinson's disease |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429339 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 396.00 |
|
| LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
USD 396.00 |
|
| LY429339 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
USD 396.00 |
|
| LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
USD 396.00 |
|
| LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
USD 396.00 |
|
| PH321446 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) |
USD 2,055.00 |
|
| TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140 |
USD 823.00 |
|
| TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112 |
USD 748.00 |
|
| TP328735 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2. |
USD 748.00 |
|
| TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3. |
USD 748.00 |
|
| TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 330.00 |
|
| TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 330.00 |
|
| TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review