alpha Synuclein (SNCA) (NM_000345) Human Recombinant Protein
CAT#: TP720923
Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
GSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
|
Tag | Tag Free |
Predicted MW | 14.7 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_000336 |
Locus ID | 6622 |
UniProt ID | P37840 |
Cytogenetics | 4q22.1 |
Refseq Size | 1543 |
Refseq ORF | 420 |
Synonyms | NACP; PARK1; PARK4; PD1 |
Summary | 'Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]' |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Parkinson's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC429339 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 325.00 |
|
LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
USD 325.00 |
|
LY429339 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
USD 325.00 |
|
LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
USD 325.00 |
|
LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
USD 325.00 |
|
PH310606 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) |
USD 2,055.00 |
|
PH321446 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) |
USD 2,055.00 |
|
TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140 |
USD 823.00 |
|
TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112 |
USD 748.00 |
|
TP328735 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2. |
USD 748.00 |
|
TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3. |
USD 748.00 |
|
TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 300.00 |
|
TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review