alpha Synuclein (SNCA) (NM_000345) Human Recombinant Protein

CAT#: TP310606

Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140

Product Images

Coomassie blue staining of purified SNCA protein (Cat# TP310606). The protein was produced from HEK293T cells transfected with SNCA cDNA clone (Cat# RC210606) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210606 representing NM_000345
  Red=Cloning site Green=Tags(s)
  
  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV
  VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000336
• Locus ID: 6622
• UniProt ID: P37840
• Cytogenetics: 4q22.1
• Refseq Size: 1543
• Refseq ORF: 420
• Synonyms: NACP; PARK1; PARK4; PD1
• Summary: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Parkinson's disease