alpha Synuclein (SNCA) (NM_000345) Human Recombinant Protein

CAT#: TP721177

Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1


  View other "SNCA" proteins (18)

USD 300.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "SNCA"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGSSHHHHHHSSGLVPRGSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAPGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA*
Tag N-His
Predicted MW 16.7 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_000336
Locus ID 6622
UniProt ID P37840
Cytogenetics 4q22.1
Refseq Size 1543
Refseq ORF 420
Synonyms NACP; PARK1; PARK4; PD1
Summary 'Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]'
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Parkinson's disease

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.