alpha Synuclein (SNCA) (NM_007308) Human Mass Spec Standard
CAT#: PH321446
SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221446 |
Predicted MW | 11.2 kDa |
Protein Sequence |
>RC221446 representing NM_007308
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_009292 |
RefSeq Size | 1096 |
RefSeq ORF | 336 |
Synonyms | NACP; PARK1; PARK4; PD1 |
Locus ID | 6622 |
UniProt ID | P37840, H6UYS5 |
Cytogenetics | 4q22.1 |
Summary | 'Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]' |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Parkinson's disease |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429339 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 396.00 |
|
LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
USD 396.00 |
|
LY429339 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 |
USD 396.00 |
|
LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 |
USD 396.00 |
|
LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 |
USD 396.00 |
|
PH310606 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) |
USD 2,055.00 |
|
TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140 |
USD 823.00 |
|
TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112 |
USD 748.00 |
|
TP328735 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2. |
USD 748.00 |
|
TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3. |
USD 748.00 |
|
TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 330.00 |
|
TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 |
USD 330.00 |
|
TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review