LIF (NM_002309) Human Recombinant Protein
CAT#: TP723270
Purified recombinant protein of Human leukemia inhibitory factor (cholinergic differentiation factor) (LIF).
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
|
Tag | Tag Free |
Predicted MW | 19.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to stimulate the proliferation of human TF-1 cells. The expected ED50 is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7 units/mg. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002300 |
Locus ID | 3976 |
UniProt ID | P15018 |
Cytogenetics | 22q12.2 |
Refseq Size | 3987 |
Refseq ORF | 606 |
Synonyms | CDF; DIA; HILDA; MLPLI |
Summary | 'The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]' |
Protein Families | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400835 | LIF HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400835 | Transient overexpression lysate of leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
USD 325.00 |
|
PH310818 | LIF MS Standard C13 and N15-labeled recombinant protein (NP_002300) |
USD 2,055.00 |
|
TP310818 | Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
USD 439.00 |
|
TP720015 | Recombinant protein of human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
USD 300.00 |
|
TP723889 | Purified recombinant protein of Human leukemia inhibitory factor (cholinergic differentiation factor) (LIF) |
USD 200.00 |
|
TP750008 | Recombinant protein of human leukemia inhibitory factor (LIF) produced in E. coli. |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review