Rabbit Polyclonal Anti-HSPA8 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA8 antibody: synthetic peptide directed towards the N terminal of human HSPA8. Synthetic peptide located within the following region: MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERL |
Rabbit Polyclonal Anti-FUS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FUS antibody: synthetic peptide directed towards the N terminal of human FUS. Synthetic peptide located within the following region: MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGY |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-ANP32A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANP32A antibody: synthetic peptide directed towards the middle region of human ANP32A. Synthetic peptide located within the following region: FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE |
Rabbit Polyclonal Anti-MSH6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal Anti-SMN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMN1 antibody: synthetic peptide directed towards the N terminal of human SMN1. Synthetic peptide located within the following region: KAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKV |
Rabbit Polyclonal Anti-PFN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL |
Rabbit Polyclonal Anti-MBD2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD2 antibody: synthetic peptide directed towards the middle region of human MBD2. Synthetic peptide located within the following region: DCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNT |
Rabbit Polyclonal Anti-GNL3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3. Synthetic peptide located within the following region: MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPNSAPFKEALLR |
Rabbit Polyclonal Anti-ORC2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Orc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Orc2. Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV |
Rabbit Polyclonal Anti-HPRT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
Germany
Japan
United Kingdom
China
