Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-PML Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PML antibody: synthetic peptide directed towards the middle region of human PML. Synthetic peptide located within the following region: TTLPPAQPAFNLQALGTYFEGLLEGPALARAEGVSTPLAGRGLAERASQQ |
Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGY |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC |
Rabbit Polyclonal Anti-BSDC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BSDC1 antibody: synthetic peptide directed towards the N terminal of human BSDC1. Synthetic peptide located within the following region: VISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKARLYSLQSDPATYC |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the middle region of human PIAS1. Synthetic peptide located within the following region: LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISL |
Rabbit Polyclonal Anti-SLC38A4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC38A4 antibody: synthetic peptide directed towards the middle region of human SLC38A4. Synthetic peptide located within the following region: LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV |
Rabbit Polyclonal Anti-UBA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBA1 antibody: synthetic peptide directed towards the N terminal of human UBA1. Synthetic peptide located within the following region: MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAV |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: FQELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEE |
Rabbit Polyclonal Anti-MID1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MID1 antibody is: synthetic peptide directed towards the N-terminal region of Human MID1. Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF |
Rabbit Polyclonal Anti-UBE2K Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the middle region of human UBE2K. Synthetic peptide located within the following region: TVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPV |
Rabbit Polyclonal Anti-UBE2K Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UBE2K antibody: synthetic peptide directed towards the N terminal of human UBE2K. Synthetic peptide located within the following region: FTELRGEIAGPPDTPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNIS |
Rabbit Polyclonal Anti-ERCC8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the middle region of human ERCC8. Synthetic peptide located within the following region: VRRASGCLITLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLTVGT |
Rabbit Polyclonal Anti-ERCC8 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSFD |
Rabbit Polyclonal Anti-KLHL9 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLHL9 antibody: synthetic peptide directed towards the middle region of human KLHL9. Synthetic peptide located within the following region: SALKGHLYAVGGRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVY |
Rabbit Polyclonal Anti-PIAS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIAS1 antibody: synthetic peptide directed towards the N terminal of human PIAS1. Synthetic peptide located within the following region: MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCS |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Rabbit Polyclonal Anti-MAP3K1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK |
Germany
Japan
United Kingdom
China
