Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
Rabbit polyclonal anti-ABCC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC3. |
ABCC4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ABCC4 |
Rabbit polyclonal anti-ABCC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCC2. |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Rabbit Polyclonal Anti-CFTR Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR. |
Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2) |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Rabbit Monoclonal antibody against PMP70
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Rabbit Polyclonal Anti-CFTR
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part. |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Rabbit Polyclonal Anti-ABCB4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Rabbit anti-ABCD3 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from human ABCD3. |
Rabbit Polyclonal Anti-ABCG5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
Rabbit Polyclonal ABCA1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
ABCG1 rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 366~395 from the Center region of Human ABCG1 |
ABCD1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of human ABCD1. |
Rabbit Polyclonal Anti-ABCA12 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCA12 Antibody: synthetic peptide directed towards the middle region of human ABCA12. Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV |
Rabbit Polyclonal Anti-ABCB6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABCB6 antibody: synthetic peptide directed towards the middle region of human ABCB6. Synthetic peptide located within the following region: VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI |
ABCB5 (N-term) rabbit polyclonal antibody, Ig Fraction
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | ABCB5 antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human ABCB5. |
MRP3 (ABCC3) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 906-933 amino acids from the Central region of human ABCC3. |
Rabbit Polyclonal ABCB5 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human ABCB5 protein (between residues 450-500) [UniProt Q2M3G0] |
Rabbit polyclonal anti-ABCB10 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB10. |
Rabbit polyclonal anti-ABCD4 antibody
Applications | WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD4. |
Rabbit polyclonal anti-ABCD1 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD1. |
Rabbit polyclonal anti-ABCB7 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB7. |
Rabbit polyclonal anti-ABCA8 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCA8. |
Rabbit polyclonal anti-ABCA6 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ABCA6. |
Rabbit polyclonal anti-ABCB1 antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Anti-ABCG1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1 |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Rabbit Polyclonal Anti-Abcc2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA |
Rabbit Polyclonal Anti-ABCC8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
Rabbit Polyclonal ABCG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Hamster |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844] |
Rabbit Polyclonal ABCB5 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCA8 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCG2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCG2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
ABCG2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ABCB5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide |
ABCC10 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 767-793 amino acids from the Central region of human ABCC10 |
ABCD2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 552-582 amino acids from the C-terminal region of human ABCD2. |
Rabbit Polyclonal ABCG8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from the N-terminal region of human ABCG8 protein. |
Rabbit anti-ABCB8 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB8. |
Rabbit anti-ABCD4 polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCD4. |
Rabbit anti-ABCB10 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB10. |
Rabbit anti-ABCB5 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide derived from Human ABCB5 (910-940 amino acid region) |
Rabbit polyclonal anti-ABCC10 (MRP7) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MRP7. |
TAP2 Rabbit Polyclonal (aa689-703) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | TAP2 antibody was raised against synthetic peptide from human TAP2. |
Rabbit Polyclonal ABCA7 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ABCA7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human ABCA7. |